SecReT6
Protein ID: 311108856
SecReT6 ID412
T6SS typei4b
Gene symbol-
Locus tagAXYL_05695
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6118626..6119132 [+]
Producthypothetical protein
NoteTssJ
UniProt IDE3HG91
KEGG IDaxy:AXYL_05695
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.60E-27, Aligned region: 14..138
Protein Sequence: 168 a.a.     [Download]
>gi|311108856|ref|YP_003981709.1| hypothetical protein AXYL_05695 [Achromobacter xylosoxidans A8]
MTGGMMDMAGLKKDPNAPVDVKLAIHAGENLNASSGQPMAVVTKIYYLKNAEAFQRAPLTQLVDTDAEKA
ALGDSIIASREVTLTPGQRYEHLEKVPKNAAYIAVAGLFYAPAPQRWKYVFEVKTAEDSGIVMGAHACAM
SVVTGQIVLPPGMPGFDPARLGSVQCPS
 
Nucleotide Sequence: 507 bp     [Download]
>ref|NC_014640.1|:6118626-6119132 hypothetical protein AXYL_05695 [Achromobacter xylosoxidans A8]
ATGACCGGCGGCATGATGGATATGGCGGGCCTGAAAAAGGACCCGAATGCGCCCGTCGATGTGAAATTGG
CGATACACGCCGGAGAAAATTTGAATGCGAGTAGCGGCCAGCCCATGGCTGTGGTTACGAAAATATACTA
TTTGAAGAATGCCGAGGCATTTCAACGCGCACCGCTCACGCAATTGGTTGATACTGACGCCGAAAAGGCG
GCATTGGGCGACAGCATCATCGCCTCGCGCGAAGTCACCCTGACGCCGGGACAGCGTTACGAGCACCTGG
AAAAAGTGCCGAAAAACGCTGCCTACATCGCTGTCGCGGGCTTGTTCTACGCGCCCGCGCCGCAGCGCTG
GAAATATGTATTCGAAGTAAAGACCGCCGAGGACAGCGGCATCGTCATGGGCGCCCATGCCTGCGCGATG
TCCGTGGTCACTGGACAGATCGTGTTGCCGCCGGGCATGCCCGGCTTCGACCCGGCCCGCCTCGGCTCGG
TGCAATGCCCGAGCTGA