SecReT6
Protein ID: 311108857
SecReT6 ID412
T6SS typei4b
Gene symbol-
Locus tagAXYL_05696
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6119214..6120560 [+]
Producthypothetical protein
NoteTssK
UniProt IDE3HG92
KEGG IDaxy:AXYL_05696
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.30E-131, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|311108857|ref|YP_003981710.1| hypothetical protein AXYL_05696 [Achromobacter xylosoxidans A8]
MSHSAKILWGEGLFLRPQHFQRQDAYHEARLAEMSRALHPYAWGLRAARFDAAALANGMLRATELSAIFP
DGEIYSAPHNDDLPPAVALDGLDGASTAVFYLALHPMKDVGGNYRDTRQEQGFDARYAHQDSPAPDLYTN
ASTAELAFLRKNVRLLSEHEPRDALLTIPVARVRRTASAGYELDTSFVAPSVTVQACSALFEQLRRLLDA
LQAKVNALYGFHREPNKNIIEFRSGDVASFWLLHTCNEAYSALSHLFHNPQLHPERLFQEMLRLAGALMT
FSKVHTLADLPAYQHDAPGAAFAQLDEILRDLLDTVISTRYFSIVLEELRPSFHVGRLDSGKLDETTALY
LSVSAATPASELAETVPLRFKVGAPDDVEKLVLSAMPGVQLVYTPQVPPAVPVKPGACYFTLQTRGSLYD
RMLQARSIAIYAPSGIPDLKLDLIAVTR
 
Nucleotide Sequence: 1347 bp     [Download]
>ref|NC_014640.1|:6119214-6120560 hypothetical protein AXYL_05696 [Achromobacter xylosoxidans A8]
GTGAGCCATTCAGCGAAGATATTGTGGGGAGAGGGGCTGTTCCTGCGGCCCCAACACTTTCAACGCCAAG
ACGCGTACCACGAGGCCCGCCTCGCGGAAATGAGCCGCGCGCTGCATCCCTATGCGTGGGGCTTGCGCGC
AGCGCGCTTCGACGCGGCGGCGCTTGCCAACGGCATGCTGCGCGCCACCGAGCTCTCCGCGATCTTTCCC
GACGGCGAGATCTACAGCGCGCCCCACAACGACGACCTGCCGCCCGCGGTAGCGCTGGACGGCCTGGACG
GCGCCAGCACGGCGGTGTTCTACCTGGCGCTGCATCCGATGAAGGACGTGGGCGGCAATTACCGCGACAC
GCGCCAGGAACAAGGCTTCGACGCGCGCTATGCGCATCAGGACAGCCCGGCGCCGGATCTCTACACCAAC
GCCAGCACGGCCGAACTTGCCTTCCTGCGCAAGAACGTGCGCCTGCTGTCGGAACACGAGCCGCGCGACG
CGCTGCTGACCATCCCCGTGGCGCGCGTGCGCCGCACCGCCAGCGCCGGCTATGAACTGGACACCAGTTT
CGTCGCCCCCAGCGTCACGGTGCAGGCTTGCAGCGCGCTGTTCGAGCAGCTGCGCCGTCTGCTTGACGCG
CTGCAAGCCAAGGTCAACGCGCTGTATGGCTTTCACCGCGAGCCGAACAAGAACATCATCGAATTCCGCT
CGGGCGACGTGGCCTCGTTCTGGCTGCTGCACACCTGCAACGAGGCTTATTCGGCGCTGTCGCACCTGTT
CCACAATCCGCAGCTGCATCCCGAGCGCCTTTTCCAGGAGATGCTGCGCTTGGCGGGCGCGCTCATGACC
TTCTCCAAGGTGCACACGCTGGCGGACCTGCCGGCCTACCAGCACGACGCGCCGGGCGCGGCCTTCGCGC
AACTGGACGAGATCCTGCGCGACCTGCTCGACACCGTCATCTCCACCCGCTACTTCTCCATCGTGCTGGA
AGAGCTGCGCCCCTCGTTCCATGTGGGCCGGCTGGACTCCGGCAAGCTCGACGAGACCACCGCGCTCTAC
CTGTCGGTGTCCGCCGCCACGCCGGCCAGCGAACTGGCCGAGACCGTGCCGCTGCGCTTCAAGGTGGGCG
CGCCCGACGACGTGGAAAAGCTGGTGCTTTCCGCCATGCCCGGCGTGCAGCTCGTCTACACGCCGCAGGT
GCCGCCCGCCGTGCCCGTCAAGCCGGGCGCGTGCTACTTCACCCTGCAGACGCGTGGCTCGCTATACGAC
CGCATGCTGCAGGCGCGCAGCATCGCCATCTATGCCCCCTCGGGCATACCCGATCTGAAACTGGACCTCA
TCGCCGTCACCCGCTAG