SecReT6
Protein ID: 311108858
SecReT6 ID412
T6SS typei4b
Gene symbol-
Locus tagAXYL_05697
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6120570..6121349 [+]
Producttype IV/VI secretion system protein, DotU family domain-containing protein
NoteTssL
UniProt IDE3HG93
KEGG IDaxy:AXYL_05697
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.00E-58, Aligned region: 29..230
Protein Sequence: 259 a.a.     [Download]
>gi|311108858|ref|YP_003981711.1| type IV/VI secretion system protein, DotU family domain-containing protein [Achromobacter xylosoxidans A8]
MTADAPSLMPGASLPPRAADFYGSRPAKSLLDLLYDGFLMLFLLKSGQEPVDAASFSARVQQFLADFERS
AKKMDIPAEDVYATKYAFCAAVDETVLNSGFSIRDAWMLQPLQLTLFGEQLAGENFFARLEDLRAQGAPR
LQSLEVFYMCLLLGFQGKYMIEGQEKLGYLTARLGDEITLLRGKRSGFAPHWPLPDKIAHTLKRDVPLWS
IGALFALLGLLAYLGMSHFLNRDMQTAMAPYHDIVKIGPRAAHLTISLP
 
Nucleotide Sequence: 780 bp     [Download]
>ref|NC_014640.1|:6120570-6121349 type IV/VI secretion system protein, DotU family domain-containing protein [Achromobacter xylosoxidans A8]
ATGACCGCCGACGCGCCTTCCCTGATGCCCGGAGCCTCGCTCCCTCCCCGAGCCGCCGATTTTTACGGTT
CGCGCCCCGCGAAGTCCTTGCTGGACCTGCTGTACGACGGCTTCCTGATGCTGTTCCTGCTGAAAAGCGG
CCAGGAACCCGTCGACGCCGCTTCGTTCTCGGCGCGCGTGCAGCAGTTCCTGGCGGACTTCGAGCGCAGC
GCCAAGAAGATGGATATCCCCGCCGAGGACGTCTACGCCACCAAGTACGCGTTCTGCGCCGCCGTGGACG
AGACCGTGCTGAACTCCGGCTTTTCCATCCGCGACGCCTGGATGCTGCAACCGCTGCAGCTGACCCTGTT
CGGCGAGCAGCTCGCCGGCGAGAACTTCTTTGCCCGCCTGGAAGACCTGCGCGCGCAGGGCGCGCCGCGC
CTGCAATCGCTGGAAGTGTTCTATATGTGCCTGCTGCTGGGCTTCCAGGGCAAGTACATGATCGAAGGCC
AGGAGAAGCTGGGCTATCTCACGGCGCGGCTGGGCGACGAGATCACGCTGCTGCGCGGCAAGCGCTCGGG
CTTCGCGCCGCACTGGCCCCTGCCCGACAAGATCGCCCACACGCTCAAGCGCGACGTGCCGCTGTGGAGC
ATCGGCGCGCTGTTCGCGCTGCTGGGCCTGCTGGCCTATCTGGGCATGAGCCACTTCCTGAACCGCGACA
TGCAGACCGCCATGGCTCCGTACCATGACATCGTCAAGATCGGGCCGCGCGCCGCGCACCTGACCATCTC
GCTCCCCTGA