SecReT6
Protein ID: 311108859
SecReT6 ID412
T6SS typei4b
Gene symbol-
Locus tagAXYL_05698
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6121389..6126590 [+]
ProductRhs element Vgr family protein 2
NoteTssI
UniProt IDE3HG94
KEGG IDaxy:AXYL_05698
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.60E-60, Aligned region: 44..365
Phage_GPD [PF05954], Evalue: 5.60E-60, Aligned region: 616..785
DUF2345 [PF10106], Evalue: 4.00E-40, Aligned region: 414..433
DUF2345 [PF10106], Evalue: 4.00E-40, Aligned region: 693..847
DUF2345 [PF10106], Evalue: 4.00E-40, Aligned region: 874..975
T6SS_Vgr [PF13296], Evalue: 2.10E-29, Aligned region: 540..648
T6SS_Vgr [PF13296], Evalue: 2.10E-29, Aligned region: 915..956
T6SS_Vgr [PF13296], Evalue: 2.10E-29, Aligned region: 1083..1112
Phage_base_V [PF04717], Evalue: 6.60E-18, Aligned region: 415..521
Phage_base_V [PF04717], Evalue: 6.60E-18, Aligned region: 1308..1323
Protein Sequence: 1733 a.a.     [Download]
>gi|311108859|ref|YP_003981712.1| Rhs element Vgr family protein 2 [Achromobacter xylosoxidans A8]
MTDRSQAPAGFSSLDVAALSQNARMLQVRTPLDAALAVERMSLREGVSELFALTLDCLASSAELDVQALL
GREISVSVLLADGGRRQWHAVVEGVDALGADGGLARYRLHAAPWLAALGLRRDSFLFQDKSVTDILTEIF
ADYPQAAYSFDIAEPPAPRPLRTQYRETDLAFVLRLLAETGLSFRFDHQQGEQQDDASGGARHRLVVFDT
RAARPACPDATLRFHRSDATETEDSITRFGGARAVQSNAVTRLAWDDRKLLAHAAHAQSDVPAGAVPRLE
DYDYDGHGRYADSDGAELAAARSLQAHEARMVRFDGGGTARQMMPGHDFTLTQHSRYAAGSGQAVDEMGG
NRYTLLHVEHEAANNLGSQAARALGESDLEHGSYRNSFSALPAAAPLAPGWRAKPTAPEGLTAVVMAAQD
APISSGRDLRIKVQFPWQRGARPLPGGLAHRSHGDDTGNAPGDDSSGTWLRVAGAQAGPNWGAHHLPRKG
TEVLVEFLDGDIDQPVASAQLYNDADLPPWSAGEDAAANHPGTLSGWHSKGLDDAGHSQWLFDDTTRQMR
TRLSSSIGATQLGLGYLVDQAADESNRGAWRGTGFELRSDAWTVVRSGQGMLVSASAREDARSTQADAQE
ALTRLRGAQHAAQRLDAAGTKRQARALAATSQYDALTRAIDPKGDGRYPGSVGGQQAVKAGGGERSGTEA
VERIDGARMLIDAPSSLNFATPASAILHAGENLHVTALADGHVAARQTFATASGRSTSLFVQDGGIRAVA
AESPVSIHAHTDMLEMLAGQDITVTSTSDSIEILANKSITLQAAGASIVMNGGDILFKGPGMFSVKGASH
NLIGPASDAAALPALPSTQVGDPMLVTAELVHRPKAKLQAQASSGQALNAAGATGSVAATAPAAAAPTAA
AAAGAQGSVLGSAGAALASGATAVSKGLTAAAEGASGMLNQAKTLAGEALKPVQELSAMAGKTLKAASDA
GSDLMSGAMTKAGGMAKTAMQNVAPSFANGAAASAAGSATQSLASMATPSLMDGGLSTMTQGAGDALAGA
VSMPQALTDAAGAVSKAGGMASQASDLASQASSLATPAAGAGPSASGVLSGASGAATAMGNATAASALGA
ASSLTAAGSGGVGSAIGPVMTQAMGAMGGRPAALSTAVNSLLTMPDVNQGNLPAVAGAILSTPGLTDSAI
PSVVGAILQSPTISSATLPKVAEAIMNIPAVANSPYPAMAKRVMEMAGVSLPGPVAKPAGAAGGQDAGGA
APAGTPDAGAPTPSAYRARSGAKLQYVNLREEDEVWNDGQALDSLDRQTNKPRIRVRFNKGGQHRFSVKV
SPRPGNAVYSAREQSRQPLYREPNQRSYSYVTDADGTKVVDNITLPAAGLNTYTFEVVNDKNQIISTEQV
ETARRLYIQEIMLPGPETLARRHGFQPTATEYARHGVDVVQLPPVSARGDANMDVFTDDGYERLRRLAAS
VYPGSQGPDHEPYTLVVCHIDRLASMLPVQPIYVQASAGPGAGDKQVQFVGADGNLSFLWYHIEPGVDWY
VECLFEYTDPAAGIRQVAIPKDRLTPVPYDPANPKACHALNIRMAGLVPVPTSGKIILKVRLMESSAGGV
AFPGTNLLGVAAMSPWEPNTLDYLQQTLVHEIGHLIGMTPSGPEWARAHPDEAEMDSSKLDKGPYFYSQF
GNHCHFGLPASQADPSHTGSCVMFGGDCVSIRFCASCAQAVRKTDMSNGWPSF
 
Nucleotide Sequence: 5202 bp     [Download]
>ref|NC_014640.1|:6121389-6126590 Rhs element Vgr family protein 2 [Achromobacter xylosoxidans A8]
ATGACCGACCGTTCCCAAGCGCCCGCCGGATTCAGCAGCCTGGATGTTGCCGCCCTTTCCCAGAACGCCC
GCATGCTGCAAGTGCGCACGCCGCTGGACGCGGCGCTCGCCGTAGAGCGCATGAGCCTGCGCGAAGGCGT
CTCCGAACTGTTTGCCCTGACGCTGGACTGCCTGGCGTCCTCGGCCGAACTGGACGTACAGGCCCTGCTG
GGCCGCGAGATCAGCGTCAGCGTGCTTCTGGCAGATGGCGGCAGGCGCCAATGGCATGCGGTGGTCGAAG
GCGTGGACGCGCTGGGCGCCGACGGCGGCCTGGCGCGCTACCGGCTGCACGCCGCGCCCTGGCTGGCGGC
CCTGGGCCTGCGCCGCGACAGCTTTCTGTTCCAGGACAAGTCGGTCACCGACATCCTCACCGAGATCTTC
GCCGACTATCCGCAGGCGGCCTACTCCTTCGACATCGCCGAGCCGCCCGCGCCGCGCCCGCTGCGCACGC
AGTACCGCGAAACCGATCTGGCTTTCGTACTGCGCCTGCTGGCCGAAACCGGCTTGAGCTTCCGCTTCGA
CCATCAGCAGGGCGAGCAGCAGGACGACGCCTCGGGCGGCGCGCGGCACCGGCTGGTCGTGTTCGACACT
CGCGCGGCGCGGCCCGCCTGCCCCGACGCCACGCTGCGCTTTCACCGCAGCGACGCCACTGAAACCGAAG
ACAGCATCACGCGTTTCGGCGGGGCCCGCGCGGTGCAGTCCAACGCCGTCACCCGCCTGGCCTGGGACGA
CCGTAAGCTGCTTGCGCACGCGGCGCATGCGCAGTCCGACGTCCCGGCCGGCGCGGTGCCTCGGCTTGAA
GACTACGACTACGATGGTCACGGCCGCTACGCCGACAGCGACGGCGCGGAACTTGCAGCCGCGCGCAGCC
TGCAGGCGCATGAAGCTCGCATGGTGCGCTTTGACGGCGGCGGCACGGCCCGCCAGATGATGCCCGGCCA
TGACTTCACGCTGACCCAGCACAGCCGCTATGCCGCGGGTTCGGGCCAGGCCGTCGATGAGATGGGCGGC
AACCGCTACACGTTGCTGCACGTTGAACACGAAGCCGCCAACAATCTGGGCAGCCAGGCCGCACGGGCGC
TGGGCGAATCCGACCTGGAGCACGGCTCGTACCGCAACAGCTTCAGCGCCCTGCCTGCGGCCGCGCCGCT
TGCGCCCGGCTGGCGCGCCAAGCCCACGGCCCCCGAGGGCCTGACAGCCGTGGTGATGGCCGCGCAGGAC
GCGCCCATTTCCTCGGGCCGCGACCTGCGCATCAAGGTGCAATTCCCCTGGCAGCGCGGCGCGCGTCCGC
TGCCGGGCGGCCTGGCGCATCGCAGCCATGGCGACGACACTGGCAACGCGCCGGGCGACGACAGTTCCGG
CACCTGGCTGCGCGTCGCCGGCGCGCAGGCCGGCCCCAATTGGGGCGCGCACCATCTGCCGCGCAAAGGC
ACCGAGGTCCTGGTCGAATTCCTGGACGGCGACATCGACCAGCCCGTGGCTTCGGCGCAGCTGTACAACG
ATGCCGACCTGCCGCCCTGGTCCGCCGGCGAGGACGCCGCGGCCAACCACCCTGGCACGCTCAGCGGCTG
GCACAGCAAGGGCCTGGACGACGCGGGCCACAGCCAGTGGCTGTTCGACGACACGACCCGGCAGATGCGC
ACCCGCCTGTCCAGCTCCATCGGCGCCACGCAGCTGGGCCTGGGCTATCTGGTCGACCAGGCCGCGGACG
AATCGAACCGCGGCGCATGGCGCGGCACCGGCTTCGAGCTGCGCTCGGATGCCTGGACCGTGGTGCGCTC
CGGGCAAGGCATGCTCGTGTCCGCCAGCGCGCGCGAAGACGCACGGTCCACCCAGGCCGACGCACAGGAA
GCGCTGACGCGCCTGCGCGGCGCGCAACATGCGGCGCAACGCCTGGATGCCGCGGGAACGAAGCGCCAGG
CGCGCGCGCTCGCGGCCACCAGCCAATATGACGCGCTGACCCGCGCCATCGACCCCAAGGGCGATGGCCG
CTATCCGGGCAGCGTTGGGGGCCAGCAGGCGGTCAAGGCCGGCGGCGGCGAACGCAGCGGCACCGAGGCG
GTCGAGCGCATCGACGGCGCCCGCATGCTGATCGACGCGCCGTCCTCCCTCAACTTTGCCACGCCCGCCT
CGGCCATCCTGCACGCCGGCGAGAACCTGCACGTCACTGCGCTGGCGGACGGCCACGTGGCCGCGCGCCA
GACCTTCGCCACGGCTTCCGGCCGCTCCACCAGCCTGTTCGTCCAGGACGGAGGCATCCGCGCCGTCGCC
GCCGAATCGCCGGTGTCGATCCACGCGCATACCGACATGCTGGAGATGCTGGCCGGCCAGGACATCACCG
TCACATCCACCTCCGACAGCATCGAGATCCTCGCCAACAAGAGCATCACTTTGCAGGCCGCGGGCGCCAG
CATCGTCATGAATGGCGGCGACATCCTGTTCAAGGGACCGGGCATGTTCTCGGTCAAGGGCGCGTCGCAC
AATCTGATCGGACCGGCCAGCGATGCGGCCGCGCTGCCCGCGCTGCCGTCCACGCAGGTGGGCGACCCGA
TGCTGGTCACGGCCGAGCTGGTGCACCGGCCCAAGGCCAAGCTGCAGGCGCAGGCCAGCTCCGGCCAGGC
GCTGAATGCCGCCGGCGCGACTGGCTCGGTAGCCGCCACCGCACCTGCCGCCGCAGCCCCCACGGCGGCT
GCGGCGGCAGGTGCGCAAGGCTCCGTGCTTGGCAGCGCGGGCGCCGCGCTTGCGAGCGGCGCGACTGCCG
TATCCAAGGGCCTGACCGCCGCAGCCGAGGGCGCGTCGGGCATGCTGAACCAGGCCAAGACCCTGGCCGG
CGAAGCGCTCAAGCCCGTGCAGGAATTGAGCGCGATGGCCGGCAAGACCCTCAAGGCCGCGAGCGATGCC
GGCTCGGACCTGATGTCCGGCGCCATGACCAAGGCCGGCGGCATGGCCAAGACCGCCATGCAGAATGTAG
CGCCCTCGTTCGCGAACGGCGCCGCGGCCTCGGCGGCAGGCAGCGCCACGCAATCCCTGGCCAGCATGGC
GACGCCATCGCTGATGGATGGCGGCCTATCCACCATGACGCAGGGCGCAGGCGACGCGCTGGCCGGCGCC
GTATCCATGCCCCAGGCGCTGACCGACGCGGCAGGCGCCGTGTCCAAGGCCGGAGGCATGGCGTCGCAGG
CGTCGGACCTGGCCTCGCAGGCGTCCAGCCTCGCCACGCCGGCCGCGGGCGCCGGTCCATCCGCCTCGGG
CGTGCTGTCGGGCGCTTCCGGCGCCGCCACGGCAATGGGCAACGCCACCGCCGCCTCCGCGCTGGGCGCC
GCCTCCAGCCTGACAGCGGCCGGCAGCGGCGGCGTGGGATCCGCCATCGGCCCGGTCATGACCCAGGCCA
TGGGCGCCATGGGCGGCCGTCCCGCCGCGCTGAGCACGGCAGTGAACTCGCTGCTGACCATGCCCGACGT
CAACCAGGGCAATCTGCCGGCGGTGGCGGGCGCGATCCTCAGCACGCCGGGCCTGACCGACTCCGCGATT
CCGTCCGTGGTCGGCGCCATCCTGCAATCGCCCACGATATCCAGCGCCACGCTGCCCAAGGTGGCGGAGG
CGATCATGAACATCCCCGCGGTGGCCAACTCGCCCTATCCGGCGATGGCCAAGCGGGTCATGGAAATGGC
CGGCGTCAGCTTGCCCGGCCCCGTCGCCAAGCCTGCGGGCGCGGCCGGCGGCCAGGATGCAGGCGGCGCC
GCCCCGGCCGGGACGCCGGATGCCGGCGCGCCCACGCCGTCCGCCTACCGGGCCAGGAGCGGCGCCAAGC
TCCAGTACGTCAACCTGCGGGAAGAGGACGAGGTCTGGAACGACGGCCAGGCGCTCGACAGCCTGGACCG
CCAGACCAACAAGCCCAGGATCCGCGTGCGCTTCAACAAGGGCGGCCAGCATCGCTTCAGCGTCAAGGTC
AGCCCGCGTCCGGGCAACGCGGTGTACTCCGCGCGCGAGCAAAGCCGCCAGCCGCTGTATCGCGAACCCA
ATCAGCGCTCCTACAGCTACGTGACCGACGCCGACGGCACCAAGGTGGTCGACAACATCACCCTGCCCGC
CGCCGGCCTGAACACCTATACGTTCGAGGTGGTGAACGACAAGAACCAGATCATCTCCACGGAACAGGTC
GAAACCGCCCGCCGCCTGTATATCCAGGAGATCATGCTGCCCGGCCCCGAGACGCTGGCGCGCCGCCACG
GCTTCCAGCCGACCGCGACGGAATACGCGCGGCACGGCGTGGACGTCGTGCAATTGCCGCCCGTCAGCGC
GCGCGGCGACGCCAACATGGACGTGTTCACGGACGACGGTTATGAACGCCTGCGCCGGTTGGCCGCCTCC
GTCTACCCGGGGTCGCAGGGCCCGGACCACGAGCCCTATACGCTGGTCGTCTGCCACATCGACCGGCTGG
CCTCGATGCTGCCCGTCCAGCCCATTTACGTGCAAGCCTCGGCCGGTCCCGGCGCAGGCGACAAGCAGGT
GCAGTTCGTCGGCGCCGATGGCAACCTCAGCTTCCTGTGGTATCACATCGAGCCTGGCGTGGACTGGTAC
GTCGAATGCCTGTTCGAGTACACCGACCCCGCGGCCGGCATCAGGCAGGTCGCCATACCCAAGGACCGAC
TGACCCCGGTGCCTTACGACCCGGCGAATCCCAAGGCCTGCCACGCCCTCAACATCCGCATGGCGGGCCT
GGTTCCCGTGCCGACCTCGGGCAAGATCATCCTGAAGGTCCGCTTGATGGAAAGCTCCGCGGGCGGCGTG
GCATTCCCCGGCACCAACCTCCTTGGCGTGGCGGCGATGAGCCCCTGGGAACCCAACACGCTGGATTATC
TGCAGCAGACGCTGGTACACGAGATCGGCCACCTGATCGGCATGACGCCCAGCGGGCCCGAGTGGGCTCG
GGCCCACCCGGACGAAGCCGAAATGGACTCGTCCAAACTCGACAAGGGGCCGTATTTCTATTCCCAGTTC
GGCAACCACTGCCACTTCGGCCTGCCCGCCAGCCAGGCCGATCCCAGCCACACCGGCTCCTGCGTCATGT
TCGGCGGCGACTGCGTCAGCATCCGCTTCTGCGCCAGCTGCGCCCAGGCCGTACGCAAGACGGACATGTC
CAATGGCTGGCCCTCGTTCTGA