SecReT6
Protein ID: 311108869
SecReT6 ID412
T6SS typei4b
Gene symbol-
Locus tagAXYL_05708
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6131997..6135302 [-]
ProductRhs element Vgr family protein 3
NoteTssI
UniProt IDE3HGA4
KEGG IDaxy:AXYL_05708
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.60E-52, Aligned region: 37..355
Phage_GPD [PF05954], Evalue: 3.60E-52, Aligned region: 456..512
Phage_GPD [PF05954], Evalue: 3.60E-52, Aligned region: 743..801
DUF2345 [PF10106], Evalue: 9.00E-39, Aligned region: 768..928
T6SS_Vgr [PF13296], Evalue: 1.10E-31, Aligned region: 602..708
T6SS_Vgr [PF13296], Evalue: 1.10E-31, Aligned region: 824..851
Phage_base_V [PF04717], Evalue: 1.30E-16, Aligned region: 444..541
Phage_base_V [PF04717], Evalue: 1.30E-16, Aligned region: 777..792
Phage_base_V [PF04717], Evalue: 1.30E-16, Aligned region: 908..940
Phage_base_V [PF04717], Evalue: 1.30E-16, Aligned region: 1068..1088
Protein Sequence: 1101 a.a.     [Download]
>gi|311108869|ref|YP_003981722.1| Rhs element Vgr family protein 3 [Achromobacter xylosoxidans A8]
MDPTATPGLFSSDARLYSLEGEGALASLQVEGWIAREALSGIAQTRVVALADNAGLDLGDMIGRPVTLWT
TRADGSRTGRSGLIREAELLSGDAGLARYRLTVAPWLWLATQQRNSRVFEARPILDIIGHVLGAYEGYVH
RVAPDASEALAGLAPRPYTTQYRETDYAFISRLLAEAGLGWTVVEDPEVPARHVALIFADSRGLAEDAES
AGGGVRFHRAAATESRDTVQALARQWRRGPDRVTVLGWHGGGKRAVAAEALARPTDGGEDAGLEWYEVAG
HGSFADEAEARRQATLAMEAVQAAAETFVGLGGVRTFRSGTRFTLQNMSPLGPAAEEGFEPAFVLDRVEH
VGINNLPPETRASLAQRLGGLDAHLALDAEAPDAPGAARAGADPARPDAEVLAKAREVGYANRFQAVRCD
RPWRPALPQARGARLSGAPSVHGVHTAIVTDADGAAQPREQDEILRNKRGDVRIRFHWQADGAEELAKSR
WARVAQRQSGAGMGMSFVPRIGQEVLVRFLDDDVDQPVVVGALYNGRGEGGTPATPGGRDGGQADTQVYA
AARDTAPSAQANLAGGNAPAWHGAAGGDENHRNAAALSGFKSKEFGGSGYNQIVFDDSDGQLRLQIKSSQ
EASELNLGHLIHQAGNYRGGLRGLGAELRTDAYGAVRGGAGVLLSTYAGTGATAGPAGEAAGLQALASQA
DQMARSLDGVVGAHQGLRLASALGSRGPEASVLDDGKAPLAAMHRAVSGTVAGDSLDGARGDASAKHTQA
ADGKVPHLTDPVVLMAARAGLAQVAGEHMQYAAGETVHWSAGKDQNLAVMGALRVHTGQGLGIVAGLQQG
GADSGLDLISATGDVHVQAQHDILRVQAQKDITIGSAQTSVEYAAPKRIRIATAAGASIVLEGGNITVTA
PGRIDVKTGNKQFAGPDQMSYALPVFVQSAPAPMKLALRLQDMPGAHGIAPEGETWRIVKVPAELNVVQQ
GGRINPQVFDSSEWSEVLGEGKTPASGELDLSEAQQYAVHSEVMANPGRVWLISGLTAQAMTPARWTTSS
EQATSERILDALNFARKGSELDTAHADWLSEHALADGSAQGMETLKPKTKA
 
Nucleotide Sequence: 3306 bp     [Download]
>ref|NC_014640.1|:c6135302-6131997 Rhs element Vgr family protein 3 [Achromobacter xylosoxidans A8]
ATGGATCCGACTGCAACGCCCGGCCTGTTCAGTTCCGACGCCCGCCTCTACAGCCTGGAAGGCGAGGGCG
CGCTTGCCTCGCTGCAGGTCGAGGGCTGGATCGCGCGCGAGGCCCTGTCGGGCATCGCCCAGACCCGCGT
GGTCGCGCTGGCCGACAACGCCGGCCTGGACTTGGGCGACATGATCGGACGCCCCGTGACCTTGTGGACC
ACGCGCGCCGACGGCAGCCGGACGGGCCGTAGCGGCCTGATCCGCGAAGCCGAACTGCTGTCGGGCGACG
CGGGCCTGGCGCGTTACCGCCTGACGGTCGCGCCCTGGCTGTGGCTGGCCACGCAGCAGCGCAACAGCCG
CGTGTTCGAAGCGCGCCCGATACTGGACATCATCGGCCACGTGCTGGGCGCGTACGAAGGCTATGTGCAT
CGCGTGGCGCCGGATGCGTCCGAAGCGCTCGCAGGGCTGGCGCCGCGCCCCTACACCACGCAGTACCGCG
AAACTGATTACGCCTTCATCAGCCGCCTGCTGGCCGAAGCGGGACTGGGCTGGACGGTGGTCGAGGATCC
CGAAGTCCCCGCGCGGCATGTGGCGCTGATCTTCGCCGACAGCCGTGGCTTGGCCGAGGACGCCGAGTCC
GCGGGCGGCGGCGTGCGCTTTCATCGCGCCGCCGCGACCGAATCGCGCGACACCGTGCAGGCCCTGGCGC
GCCAGTGGCGGCGCGGCCCGGATCGCGTCACTGTCCTGGGCTGGCACGGCGGCGGCAAGCGCGCGGTGGC
GGCCGAGGCCTTGGCGCGTCCCACCGATGGCGGCGAGGACGCCGGCCTGGAATGGTACGAGGTAGCCGGC
CACGGCAGCTTTGCCGATGAGGCCGAAGCGCGGCGCCAGGCGACTTTGGCGATGGAAGCCGTGCAGGCCG
CTGCAGAGACCTTTGTCGGCCTGGGCGGCGTGCGCACCTTCCGTTCTGGCACGCGCTTCACCTTGCAGAA
CATGTCTCCGCTGGGTCCCGCCGCTGAAGAGGGCTTCGAACCCGCCTTCGTGCTGGACCGGGTCGAGCAC
GTCGGCATCAACAACCTGCCGCCCGAGACCCGCGCCTCGCTGGCACAGCGTCTGGGCGGGTTGGACGCGC
ATCTGGCGCTGGATGCCGAGGCGCCCGACGCGCCAGGCGCAGCGCGCGCGGGCGCCGATCCGGCGCGGCC
CGACGCTGAAGTGCTGGCGAAAGCACGCGAGGTCGGCTACGCCAACCGCTTCCAGGCGGTGCGTTGCGAC
CGTCCCTGGCGGCCGGCCCTGCCGCAGGCGCGCGGCGCACGCCTGAGCGGCGCGCCTTCGGTCCATGGTG
TGCACACAGCCATCGTCACGGACGCGGACGGCGCGGCGCAGCCGCGGGAGCAGGACGAGATCCTGCGCAA
CAAGCGCGGCGACGTGCGCATCCGTTTCCATTGGCAGGCCGACGGCGCGGAGGAGCTGGCCAAGAGCCGC
TGGGCCCGCGTGGCGCAGCGCCAATCGGGCGCAGGCATGGGCATGAGCTTCGTGCCCCGCATCGGCCAGG
AGGTGCTGGTGCGCTTCCTGGACGACGACGTGGATCAGCCCGTCGTCGTGGGCGCGCTGTACAACGGCCG
CGGCGAGGGCGGCACGCCCGCCACGCCGGGCGGCCGCGACGGCGGCCAGGCCGACACCCAGGTCTACGCC
GCCGCGCGCGATACCGCGCCCAGCGCCCAGGCGAACCTGGCGGGAGGCAACGCGCCCGCCTGGCATGGCG
CGGCCGGCGGCGACGAAAACCACCGCAACGCCGCCGCGCTCAGCGGCTTCAAGAGCAAGGAGTTCGGCGG
CTCGGGCTACAACCAGATCGTGTTCGACGACAGCGACGGACAACTGCGTTTGCAGATCAAGAGCAGCCAG
GAAGCCAGTGAACTGAACCTGGGCCACCTGATCCATCAGGCTGGCAACTACCGTGGCGGCCTGCGCGGCC
TGGGCGCCGAGTTGCGCACGGACGCTTACGGCGCCGTGCGCGGCGGCGCGGGCGTGCTGCTCAGCACCTA
CGCCGGGACCGGCGCCACCGCCGGCCCCGCAGGCGAAGCCGCGGGCTTGCAGGCGCTGGCCAGCCAGGCC
GACCAGATGGCGCGTTCGCTGGACGGCGTGGTCGGCGCGCACCAGGGCCTGCGGCTGGCGAGTGCGCTCG
GCTCCAGGGGGCCCGAAGCCAGTGTGCTGGATGATGGCAAGGCGCCGCTCGCGGCCATGCATCGTGCCGT
GTCCGGCACCGTTGCGGGCGACAGCCTGGATGGCGCGCGCGGCGACGCCTCGGCCAAGCACACGCAGGCG
GCCGACGGCAAGGTGCCGCACCTCACCGATCCGGTCGTGCTGATGGCCGCGCGCGCCGGCCTGGCGCAGG
TCGCCGGCGAACACATGCAATACGCCGCCGGCGAGACCGTGCACTGGTCTGCCGGCAAGGACCAGAACCT
GGCCGTGATGGGCGCGCTGCGCGTGCATACCGGGCAGGGCCTGGGCATCGTCGCCGGCCTGCAGCAGGGC
GGCGCGGATTCCGGCCTGGACCTGATCTCCGCCACCGGCGACGTGCATGTCCAGGCCCAGCACGACATCC
TGCGCGTGCAGGCGCAGAAGGACATCACCATCGGCAGCGCGCAGACCTCTGTCGAATACGCCGCGCCCAA
GCGCATCCGCATCGCCACCGCGGCCGGCGCCAGCATCGTGCTGGAAGGCGGCAACATCACGGTGACCGCG
CCGGGGCGGATCGATGTGAAGACGGGGAACAAGCAGTTTGCGGGCCCGGACCAGATGTCCTATGCCCTGC
CCGTGTTCGTGCAGAGCGCGCCCGCACCGATGAAGCTGGCGCTGCGCCTGCAGGACATGCCGGGGGCGCA
CGGCATCGCGCCGGAAGGCGAGACTTGGCGCATCGTGAAGGTGCCTGCGGAACTGAACGTGGTTCAGCAG
GGTGGGCGCATCAATCCCCAGGTGTTCGATTCCTCGGAGTGGTCCGAGGTCTTGGGCGAAGGGAAGACGC
CCGCCAGCGGCGAACTCGACCTGTCGGAAGCGCAGCAGTACGCGGTCCACAGCGAAGTGATGGCGAATCC
TGGCCGTGTGTGGCTGATCAGCGGCCTGACCGCGCAAGCCATGACGCCGGCGCGCTGGACGACAAGCTCG
GAGCAGGCGACGTCGGAGCGGATCCTCGATGCCCTGAATTTTGCGCGCAAGGGTTCGGAACTGGACACGG
CGCACGCCGACTGGCTGTCCGAGCATGCCTTGGCCGACGGGTCGGCGCAGGGCATGGAGACGCTCAAACC
CAAGACGAAGGCATAA