SecReT6
Protein ID: 311108876
SecReT6 ID412
T6SS typei4b
Gene symbol-
Locus tagAXYL_05715
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6144335..6145441 [-]
ProductImpA-related N-terminal domain-containing protein 1
NoteTssA
UniProt IDE3HGB1
KEGG IDaxy:AXYL_05715
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.50E-25, Aligned region: 54..115
Protein Sequence: 368 a.a.     [Download]
>gi|311108876|ref|YP_003981729.1| ImpA-related N-terminal domain-containing protein 1 [Achromobacter xylosoxidans A8]
MSDIDTLLQPIAGDAPCGADLVFSAEFDAIREARRHDDPNLDQGDWVIAIKEADWPEVIRICTTVLREQS
KDVRVAAWLAEAWAKTRGFAGLRDGYLLVDGLCRHYWDGLHPVPDEGDVQQRVGNLAWLLARSQQLIREL
PLTQSEGGRYGAALWDSASQLANAVKRAPQNAAEITRGKLTLDQFDAARRDTPPAFYSELEGNLQSCFAA
VDTLEQTLAERLGDEGPAFSPVRDALRDVTELTRRFARDAGLLVRADTAAPAAAPAAPATARMEPTLSTA
DPVPAAPASAPARGPLQTRDQALAQLREVAEFFRRTEPHSPVAYLADKAASWGEMSLHLWLRTVLKNGDA
LSGLEELLGVPKPPDHNG
 
Nucleotide Sequence: 1107 bp     [Download]
>ref|NC_014640.1|:c6145441-6144335 ImpA-related N-terminal domain-containing protein 1 [Achromobacter xylosoxidans A8]
ATGAGCGATATCGACACACTGCTGCAGCCCATTGCGGGCGATGCGCCTTGCGGCGCCGACCTGGTGTTTT
CCGCCGAGTTCGACGCCATACGCGAAGCCCGCCGCCACGATGATCCGAACCTGGACCAGGGCGATTGGGT
CATAGCCATCAAAGAGGCCGATTGGCCGGAAGTCATCCGCATCTGCACCACGGTGCTGCGCGAACAGAGC
AAGGACGTGCGCGTGGCCGCCTGGCTGGCCGAAGCCTGGGCCAAGACGCGCGGCTTTGCCGGCCTGCGCG
ATGGCTATCTGCTGGTGGACGGCCTGTGCCGCCACTACTGGGACGGCCTGCATCCCGTGCCGGACGAGGG
CGACGTGCAGCAGCGCGTGGGCAATCTGGCCTGGCTGCTGGCGCGCTCGCAACAGCTGATCCGCGAACTG
CCGCTGACGCAGTCCGAAGGCGGACGCTATGGCGCGGCCTTGTGGGACAGCGCCTCGCAACTGGCCAATG
CGGTCAAGCGCGCGCCGCAGAATGCCGCCGAGATCACCCGGGGCAAGCTCACTCTGGATCAGTTCGATGC
CGCGCGCCGCGACACGCCGCCGGCCTTTTACTCCGAACTGGAAGGCAATCTGCAAAGCTGCTTCGCGGCG
GTGGACACGTTGGAGCAGACCCTGGCGGAGCGCCTGGGCGACGAAGGCCCGGCTTTTTCGCCGGTGCGCG
ACGCGCTGCGCGACGTGACCGAACTGACCCGCCGCTTCGCCCGCGACGCCGGGCTGCTGGTGCGCGCGGA
TACCGCGGCGCCGGCCGCTGCCCCCGCCGCGCCCGCAACCGCCCGGATGGAGCCGACCTTGTCCACAGCC
GATCCCGTACCCGCCGCGCCCGCGTCCGCGCCTGCGCGCGGCCCGCTGCAAACGCGCGACCAGGCGCTGG
CGCAGCTGCGCGAAGTGGCGGAGTTCTTCCGCCGCACCGAGCCTCACAGCCCCGTGGCCTATCTGGCCGA
CAAGGCCGCCAGCTGGGGCGAGATGTCACTGCACCTGTGGCTGCGCACGGTCCTCAAGAACGGCGACGCG
CTGTCCGGACTGGAAGAGCTGCTGGGCGTGCCCAAGCCGCCGGACCACAACGGCTGA