SecReT6
Protein ID: 315123147
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0204
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]227087..228358 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDE6RQP0
KEGG IDpsm:PSM_B0204
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.30E-15, Aligned region: 28..96
Phosphoesterase [PF04185], Evalue: 0.0077, Aligned region: 52..165
Phosphoesterase [PF04185], Evalue: 0.0077, Aligned region: 209..234
Phosphoesterase [PF04185], Evalue: 0.0077, Aligned region: 281..367
Protein Sequence: 423 a.a.     [Download]
>gi|315123147|ref|YP_004065153.1| FHA domain-containing protein [Pseudoalteromonas sp. SM9913]
MELILNITSYHRLSPEIEATKTVKDSLTFGRSEGCDWHLPDPEKIISSKHGRIEKEGDSFYIYDNSTNGL
FINFAVAPLGQGNKQRLSDSDVLTIGDFQVDVSLADEPHADISNPITSNSSQQVSTFASHSSQTAESAPL
FNDSIMNESMPAVSVISQQATADNHIPEDWDELTRLMNTDEFDLGNDEVNSSAPVDTPAPIKESAPTKRY
NAEQQAVKQTAPVKSFAQNDKVFCDAFLNGLGIKDELKSALDNEKLWFEMGQGLSLLLTELMESLRQRAI
VKNKLRLNHTMFQTEQNNPLKFSANIDDVIQNLFIKNSASFLSSNESIKESFVDTRKHEQALLAGADGVL
KGMLSQVSPVQINQQANDNSNVLKIIPGQIESKCWKLYQSLYDDISQEVNAKGAMAMSDDFLKAYNDRIK
ETL
 
Nucleotide Sequence: 1272 bp     [Download]
>gi|315122943|ref|NC_014800.1|:227087-228358 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
ATGGAACTGATACTAAACATCACTAGTTATCACAGACTTTCGCCTGAAATCGAAGCTACCAAAACGGTAA
AAGATTCACTCACTTTTGGTCGCTCTGAGGGATGCGATTGGCATCTCCCCGATCCTGAAAAAATTATCTC
AAGTAAGCACGGTAGAATTGAAAAAGAAGGCGATTCTTTTTATATATACGATAATTCAACCAATGGTTTG
TTTATTAATTTTGCAGTGGCGCCTTTAGGTCAAGGTAATAAACAACGTTTGTCAGATAGTGATGTCTTAA
CTATTGGTGATTTTCAGGTTGATGTTAGTTTAGCTGATGAGCCACACGCAGATATTAGTAATCCTATTAC
TTCAAACAGTTCTCAACAAGTAAGTACATTTGCTTCACATAGTAGTCAAACTGCAGAGTCTGCGCCGTTA
TTCAATGATTCAATTATGAATGAGTCTATGCCTGCGGTATCTGTAATTTCACAACAAGCAACAGCGGATA
ATCATATTCCAGAAGATTGGGATGAGCTAACTCGCCTTATGAATACCGATGAGTTTGATCTTGGTAATGA
CGAAGTGAATTCTTCAGCGCCAGTTGACACTCCAGCTCCAATAAAAGAAAGTGCGCCGACTAAACGTTAT
AATGCTGAGCAGCAAGCTGTAAAACAAACAGCGCCTGTAAAAAGCTTTGCTCAAAATGATAAAGTGTTTT
GTGATGCCTTTTTAAACGGATTGGGGATTAAGGATGAGCTTAAAAGTGCTCTAGATAATGAAAAGCTGTG
GTTTGAGATGGGGCAGGGCTTAAGTTTGTTACTGACAGAGCTCATGGAATCTTTACGCCAACGCGCGATT
GTAAAGAACAAATTAAGACTGAACCATACAATGTTTCAGACCGAACAGAACAACCCATTGAAGTTTTCTG
CCAATATTGATGATGTTATTCAGAACTTGTTCATAAAAAATAGTGCAAGCTTTCTGTCTTCGAATGAATC
TATTAAAGAAAGCTTTGTAGATACACGCAAGCACGAGCAAGCACTGCTCGCTGGTGCAGATGGCGTGCTC
AAAGGGATGTTATCGCAAGTTTCTCCCGTGCAAATTAATCAACAGGCAAACGATAATTCTAACGTGTTAA
AAATTATTCCAGGCCAAATAGAGTCTAAATGCTGGAAGTTATATCAAAGTTTATATGATGATATTTCTCA
GGAAGTTAACGCGAAAGGCGCTATGGCTATGTCTGATGATTTTTTAAAAGCATATAACGATCGAATCAAA
GAAACGCTCTAG