SecReT6
Protein ID: 315123148
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0205
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]228374..228838 [+]
Producthypothetical protein
NoteTssJ
UniProt IDE6RQP1
KEGG IDpsm:PSM_B0205
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.50E-38, Aligned region: 15..146
Protein Sequence: 154 a.a.     [Download]
>gi|315123148|ref|YP_004065154.1| hypothetical protein PSM_B0205 [Pseudoalteromonas sp. SM9913]
MHKVKLYLMSFSLLFLVLGCTTMNKIVPPSTDLIINVSKNVNPDTSERPSPVVMKIFELSSRTIFDTQDF
FSLYDTPEKILGPDLLKKDELELQPDSVQQYKMSLNRNTRYVGVVVAYRNIDQARWRAVIEVDPTGYDDI
NVNVEAIATYMREQ
 
Nucleotide Sequence: 465 bp     [Download]
>gi|315122943|ref|NC_014800.1|:228374-228838 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
ATGCATAAAGTTAAGCTCTATTTAATGAGTTTTAGTTTACTATTTTTGGTACTGGGATGTACTACGATGA
ATAAAATCGTACCTCCTTCTACAGATCTGATCATCAATGTATCTAAAAATGTTAATCCGGATACATCAGA
ACGCCCTTCTCCGGTGGTGATGAAAATTTTTGAGTTGAGCTCAAGAACAATTTTTGACACGCAGGATTTT
TTTAGCTTATACGATACGCCAGAAAAGATATTAGGCCCTGATTTATTAAAAAAGGATGAGTTAGAGCTTC
AACCTGATTCAGTACAGCAATATAAAATGAGCCTTAATCGTAATACTCGTTATGTTGGGGTTGTTGTTGC
TTACAGAAATATAGACCAAGCAAGGTGGAGAGCGGTTATTGAAGTTGACCCCACCGGTTATGACGACATC
AATGTAAATGTAGAAGCGATTGCTACATACATGAGAGAGCAATAA