SecReT6
Protein ID: 315123149
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0206
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]228854..230182 [+]
Producthypothetical protein
NoteTssK
UniProt IDE6RQP2
KEGG IDpsm:PSM_B0206
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.00E-137, Aligned region: 19..441
Protein Sequence: 442 a.a.     [Download]
>gi|315123149|ref|YP_004065155.1| hypothetical protein PSM_B0206 [Pseudoalteromonas sp. SM9913]
MGDNTRVAWTEGMFLRPQHFQQSDKYISNVIKQVCSGNLADPWGIIDISIDNELLNSGQFAVDSLTAITP
DLLPIDMPQSTSLPEPLVVNKDVFDEIVYLAIPALKNSGVNISSTDDNMVTRYKLNDLAVSDDLLGAQSQ
EIIQVAKVYSKLMLSSDDHSGYIVLPLARIVDVSSEGQIKLDAKYIPPSLKVGQCKPLSGLVREIGSMIK
QRAESIAARLCQGYAGSTSVADFIMLQTLNKYDAIFNNLLSVNSLHPNVFYSRLIELAGELSTFSTANKR
VPKLPNYDHTNLGQVFSEVVNFLYQSLSHVIEQTATEIKLEQSKFGISFGALKDKSILNSAQFVLAIKAS
VPHEELRKILPSQIKIGSVETIRDLVNNQIPGITISNLPTAPRQIPYHAGFHYFELNRHGEHWEKLRSSG
GIAIHLSGSYPELQLSLWAIRT
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|315122943|ref|NC_014800.1|:228854-230182 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
ATGGGTGATAACACTCGTGTTGCTTGGACTGAGGGGATGTTTTTAAGACCTCAGCACTTTCAGCAATCAG
ATAAATATATTTCAAATGTGATTAAGCAAGTATGCAGTGGAAACCTTGCTGATCCATGGGGAATAATTGA
TATTAGTATTGATAATGAATTACTTAACAGTGGTCAATTCGCTGTTGATTCATTAACTGCAATCACCCCG
GATCTATTGCCAATTGATATGCCTCAGTCAACCTCTTTACCTGAGCCTTTAGTGGTTAATAAAGATGTGT
TTGATGAAATTGTTTATTTGGCTATTCCTGCGCTAAAAAATAGTGGCGTTAATATATCGTCAACTGACGA
TAATATGGTTACTCGCTATAAGCTTAACGATTTGGCAGTGAGTGATGACTTATTGGGAGCGCAGTCTCAA
GAAATAATTCAAGTTGCAAAAGTATACAGTAAGTTGATGCTGTCTTCTGATGATCATTCAGGGTATATCG
TGTTGCCTTTAGCACGAATAGTGGATGTGAGCAGCGAAGGGCAAATAAAGTTAGATGCAAAGTACATTCC
TCCCTCTTTAAAAGTAGGGCAGTGTAAACCTTTATCGGGGCTAGTGAGAGAAATTGGCTCAATGATAAAG
CAACGCGCTGAAAGCATTGCTGCTAGGTTGTGCCAAGGTTATGCGGGTAGTACGTCAGTTGCAGATTTTA
TAATGCTGCAAACACTAAATAAATATGACGCGATATTTAATAATTTGCTCAGCGTTAATAGTTTACATCC
GAACGTGTTTTATAGCCGCTTAATTGAACTGGCAGGTGAGTTATCAACCTTTAGCACGGCTAATAAAAGA
GTGCCTAAATTACCTAATTATGATCACACAAATTTAGGGCAAGTGTTTAGTGAAGTGGTTAACTTTTTAT
ACCAATCATTAAGCCATGTAATTGAGCAAACCGCGACTGAAATTAAGCTTGAACAAAGTAAGTTTGGTAT
TTCGTTTGGTGCCTTAAAAGATAAATCTATTTTAAATTCAGCGCAGTTTGTTTTAGCAATTAAAGCAAGC
GTTCCGCATGAAGAGTTGAGAAAAATTCTACCTTCGCAAATTAAAATTGGCAGCGTTGAAACCATTCGTG
ATCTTGTTAACAACCAGATCCCAGGTATTACAATTAGTAACTTGCCAACAGCGCCAAGACAGATCCCTTA
CCATGCTGGTTTTCATTATTTTGAATTAAATCGCCATGGTGAACATTGGGAAAAACTGCGCTCCAGCGGA
GGAATTGCTATCCACCTCTCAGGAAGTTACCCAGAACTCCAATTAAGCCTTTGGGCTATTAGAACTTAA