SecReT6
Protein ID: 315123150
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0207
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]230205..231485 [+]
Producthypothetical protein
NoteTssL
UniProt IDE6RQP3
KEGG IDpsm:PSM_B0207
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.40E-61, Aligned region: 52..255
OmpA [PF00691], Evalue: 6.00E-14, Aligned region: 320..418
Protein Sequence: 426 a.a.     [Download]
>gi|315123150|ref|YP_004065156.1| hypothetical protein PSM_B0207 [Pseudoalteromonas sp. SM9913]
MDETIIKPRPGRLGRNTPSSGAAQNDADKTVMSVEPPSAKPMSNNKVSIFKNPLLEAATDCFSLVISINQ
SLEMSNLAALKHRCVEAIKRFEVEVRNQHLSKEVINNSRYCLCAILDESVLNSKWSSMEWADESLLSTFH
KETFGGEYFYTLLDAGLGQPEKNKQFLELQYHCLNLGFKGKYRLDAGGDTKVEEYRSQLYHLLNQLDGPI
NNKLSPNWQQRVAAGVELRNQVPLWVIFSVLGLILLMIYLSINMKLNNDVFAINEKLAGIHPLAVNQTVD
KKDQQLRVLEQLLQTEIKMGIVAVAKNSDGIRITINSENLFKQGDSQLLPSFQPILEKLALSLEGTKGRV
LITGHTDDLPISTDKYPSNWHLSLARATQVANLMAKSTNLSGRLWPEGKGAAEPIASNSDSASRSLNRRI
EIDLLF
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|315122943|ref|NC_014800.1|:230205-231485 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
ATGGACGAAACCATTATAAAACCACGCCCTGGCCGACTAGGGCGAAATACCCCAAGCAGTGGTGCAGCGC
AAAATGATGCTGATAAAACCGTTATGTCGGTTGAGCCACCCTCTGCAAAGCCGATGAGCAATAATAAGGT
ATCAATTTTTAAAAATCCCTTGTTAGAAGCGGCAACAGATTGCTTTTCTCTTGTGATATCCATAAATCAA
TCGCTTGAAATGAGCAATCTAGCAGCGCTCAAGCACCGCTGTGTTGAGGCTATAAAGCGTTTTGAAGTGG
AAGTCCGTAACCAGCACCTATCAAAAGAAGTGATTAATAATTCACGCTATTGCCTATGCGCTATTCTTGA
TGAGTCTGTATTGAATTCAAAGTGGAGCTCAATGGAGTGGGCTGATGAAAGTCTGCTGTCGACTTTTCAC
AAAGAAACCTTTGGTGGTGAGTATTTTTATACTCTACTTGATGCCGGGTTAGGGCAACCTGAAAAAAACA
AACAGTTTTTGGAGTTGCAATACCACTGTTTAAACTTAGGCTTTAAAGGGAAATATCGATTAGATGCCGG
CGGCGATACAAAAGTCGAAGAGTATCGTTCACAGCTTTACCATTTACTCAATCAGCTTGATGGCCCGATT
AATAATAAACTATCTCCAAACTGGCAACAAAGAGTTGCTGCAGGTGTTGAACTAAGAAATCAAGTGCCAC
TGTGGGTCATATTTTCTGTGCTGGGGCTGATATTATTGATGATTTATCTATCAATAAATATGAAGCTAAA
TAACGATGTTTTTGCGATTAATGAAAAACTAGCGGGCATTCATCCGTTAGCTGTTAATCAAACGGTTGAT
AAAAAAGATCAGCAGCTGCGTGTACTTGAACAGTTACTGCAAACAGAAATTAAAATGGGGATTGTTGCTG
TTGCAAAAAATTCCGATGGGATCCGCATAACGATAAACAGTGAAAATTTGTTTAAACAAGGGGATTCTCA
ACTACTTCCATCATTTCAGCCTATTTTAGAAAAGTTAGCGTTAAGCTTAGAGGGAACTAAAGGGCGAGTG
CTTATAACGGGCCACACAGATGACTTACCAATTAGTACAGATAAGTATCCTTCTAATTGGCATCTTTCTT
TAGCCAGAGCAACACAGGTTGCTAATTTAATGGCTAAAAGTACCAACTTAAGCGGTCGTTTATGGCCAGA
AGGAAAGGGCGCTGCAGAGCCTATCGCCAGCAATTCAGATTCAGCTTCTCGGTCATTAAACCGACGAATT
GAAATCGATCTATTATTTTAA