SecReT6
Protein ID: 315123154
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0211
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]236708..237823 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDE6RQP7
KEGG IDpsm:PSM_B0211
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.80E-16, Aligned region: 61..122
Protein Sequence: 371 a.a.     [Download]
>gi|315123154|ref|YP_004065160.1| ImpA domain-containing protein [Pseudoalteromonas sp. SM9913]
MFLFEEYISPISDAEFAGIDPRSDVSPTSTYYALKDLRNQLRAAERNALVDEEGIASLSRDWLPLLEQCS
EAVKSESKDIEYLAWLIEGLCRVHGFKGIAFGFSVAKHLLEHHFESLYPTLDDGDEISDKVSALVGLNGT
AGEGTLIIPIKSIYMTDSVSMDPFSFWEYQQGYDISRLNDEKREKKIAQGAVDFEQLEKSAAETSTEFFV
SLKNDIEDAIEQFAALSEVMDEVTGEPQPTSNIKQALEVSLAAVKHVAADKLEAAQTALDKANAEPEEEL
VEDAIQADSEQPKKLSSDEINSRENAIKKLQEIATFFRKTEPHSPMSYTIEQVIRWSELSLPELLNELIT
DSDARTGYFKLSGIKISETET
 
Nucleotide Sequence: 1116 bp     [Download]
>gi|315122943|ref|NC_014800.1|:236708-237823 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
ATGTTTTTATTTGAAGAGTATATTTCCCCTATTTCAGATGCTGAGTTTGCAGGTATTGATCCGCGCTCAG
ACGTCTCTCCAACGTCTACTTACTATGCCTTAAAAGATTTAAGAAACCAACTTCGTGCGGCTGAAAGAAA
TGCCTTAGTCGATGAAGAGGGAATTGCTTCACTTTCGCGAGATTGGCTGCCATTACTTGAACAATGCAGT
GAGGCAGTTAAAAGCGAAAGCAAGGATATTGAATACCTTGCATGGCTAATTGAAGGTTTATGCCGCGTTC
ACGGGTTTAAAGGAATAGCGTTTGGTTTTAGTGTTGCTAAGCACCTTTTGGAACACCATTTTGAATCCCT
TTATCCAACACTTGATGACGGTGATGAAATTTCAGACAAAGTGTCTGCCTTAGTTGGCTTAAATGGTACA
GCCGGTGAAGGCACGTTGATCATCCCAATAAAAAGCATTTATATGACAGACAGTGTCAGTATGGATCCTT
TTTCTTTTTGGGAGTATCAGCAAGGGTATGATATTTCGCGTTTAAATGATGAAAAGCGCGAAAAGAAAAT
AGCCCAAGGCGCAGTTGATTTTGAGCAATTAGAAAAAAGTGCCGCTGAGACCAGTACCGAATTTTTTGTG
TCTTTAAAAAACGATATTGAAGATGCGATAGAGCAGTTTGCTGCCTTGAGCGAAGTTATGGATGAGGTGA
CAGGTGAGCCACAACCGACGTCTAACATCAAACAAGCATTAGAAGTGAGCTTAGCGGCGGTAAAACACGT
AGCAGCAGATAAGCTTGAAGCAGCGCAAACTGCACTAGATAAAGCTAACGCTGAGCCTGAAGAGGAACTC
GTTGAGGATGCGATTCAAGCTGACTCAGAGCAACCTAAAAAGCTTAGCAGTGATGAGATTAATTCAAGAG
AAAACGCAATTAAGAAACTTCAAGAAATTGCGACTTTTTTCAGAAAGACTGAACCTCATTCACCGATGTC
TTACACGATAGAACAAGTTATTCGATGGAGCGAATTATCGCTACCTGAGTTATTAAATGAGTTAATTACA
GATAGTGATGCTAGGACTGGATACTTTAAGTTGTCTGGCATTAAGATCAGCGAAACTGAAACATAG