SecReT6
Protein ID: 315123155
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0212
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]237839..238342 [+]
Producthypothetical protein
NoteTssB
UniProt IDE6RQP8
KEGG IDpsm:PSM_B0212
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.60E-62, Aligned region: 7..162
TFIID_20kDa [PF03847], Evalue: 0.0078, Aligned region: 123..151
Protein Sequence: 167 a.a.     [Download]
>gi|315123155|ref|YP_004065161.1| hypothetical protein PSM_B0212 [Pseudoalteromonas sp. SM9913]
MSIHDKLKRVRKPRVHITYDVETEGAAVKKELPFVVGVMGDFSGDNTEALKPLKDRRFIQIDRDNFNDVL
KRMSPSLRLKVDNTLTDDGSQFEVNLNFKSIDDFEPAAVVNQVEPLRKLMETRNKLRDLMTKIDRSEELE
NVLEEVLSNTASLDSMAKELNLEETDK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|315122943|ref|NC_014800.1|:237839-238342 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
ATGAGTATCCATGATAAGTTAAAACGAGTTCGTAAACCTAGAGTACATATCACTTATGATGTGGAAACTG
AGGGCGCGGCAGTAAAAAAAGAATTACCCTTTGTAGTGGGTGTAATGGGCGATTTTTCTGGTGATAATAC
AGAAGCGCTTAAGCCACTAAAAGATAGACGTTTTATTCAAATTGATCGTGATAACTTTAATGATGTTTTA
AAGCGTATGAGCCCATCTCTACGTTTAAAAGTAGACAACACATTAACGGATGATGGTTCTCAGTTTGAAG
TTAACTTGAACTTCAAATCGATTGACGATTTCGAGCCTGCAGCCGTTGTAAATCAAGTAGAGCCGTTACG
CAAATTGATGGAAACGCGTAACAAGCTTCGTGACTTGATGACGAAGATTGACCGCTCAGAAGAACTTGAA
AACGTACTAGAAGAAGTATTAAGCAACACAGCAAGCTTAGACTCGATGGCGAAAGAACTTAACTTAGAGG
AGACTGATAAATGA