SecReT6
Protein ID: 315123156
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0213
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]238339..239829 [+]
Producthypothetical protein
NoteTssC
UniProt IDE6RQP9
KEGG IDpsm:PSM_B0213
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-190, Aligned region: 63..493
Protein Sequence: 496 a.a.     [Download]
>gi|315123156|ref|YP_004065162.1| hypothetical protein PSM_B0213 [Pseudoalteromonas sp. SM9913]
MSTEQLATESESVAEVSSSLLEQAIGATKQTESSRAEELLKTLTEEALKGTVQWNKNMTVTFNEAIQLID
QKISKQLSVVMHTDEFQKLEGSWRGLHHLVMNSETSSTLKIRVLNMKKKELHKDLSKAVEFDQSQTFKKI
YESEFGTPGGEPYGTIVGDFEFTNHPEDVETLSLMSNVAAAGFCPFIAASSPSLFGFDNWEELTKPRDLE
KVFESLEYTKWRSFRDSDDSRFVSLTMPRFLSRLPYGAASKPVEEFNYEEFEVEAKDGRSVSTDNSDYCW
SNAAYAMATNMTAAFSQYGFCTAIRGAEGGGKVEGLPTHIFTSDDGDPDLKCPTEIGITDRREAELSQLG
FLPLCHYKNTDYAVFFGGQSCQKPKIYSTPDATANAAISARLPYLMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILSYVNATEGGGQDIRARYPLADAKVSVKEIPGQPGAYNAVAWLKPWLQMEELTSSLRLVA
KIPEIG
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|315122943|ref|NC_014800.1|:238339-239829 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
ATGAGCACTGAACAATTAGCAACAGAATCAGAATCAGTAGCAGAAGTTAGTTCTTCACTTTTAGAGCAAG
CAATCGGTGCGACTAAACAAACAGAGTCAAGCCGTGCTGAAGAGTTACTGAAAACGTTAACTGAAGAAGC
ATTAAAAGGCACAGTTCAATGGAACAAAAACATGACTGTGACGTTTAATGAAGCAATTCAATTAATCGAT
CAAAAAATCTCAAAGCAGTTAAGTGTCGTAATGCACACGGATGAGTTTCAAAAACTTGAAGGCTCATGGC
GCGGATTACATCACTTAGTGATGAATTCTGAAACTAGCTCAACATTAAAAATTCGTGTTTTAAACATGAA
AAAGAAAGAGCTGCATAAAGACTTAAGTAAAGCTGTTGAGTTTGATCAAAGCCAAACCTTTAAGAAAATA
TATGAGTCAGAATTTGGTACCCCAGGTGGTGAACCGTATGGCACGATTGTAGGTGACTTTGAATTTACTA
ATCACCCAGAAGATGTTGAAACATTAAGCTTAATGTCTAATGTTGCAGCTGCTGGTTTCTGTCCATTTAT
TGCCGCATCATCACCGTCGTTATTTGGTTTTGATAATTGGGAAGAATTAACTAAGCCACGTGATTTAGAA
AAAGTGTTTGAATCACTAGAATACACTAAATGGCGTTCATTTAGAGACAGCGATGATTCACGCTTTGTAT
CACTTACTATGCCGCGTTTCCTTTCGCGTTTACCTTATGGTGCAGCGTCAAAACCAGTTGAAGAATTTAA
CTACGAAGAGTTTGAAGTTGAAGCGAAAGATGGCCGTTCAGTTAGTACTGATAATAGTGATTATTGTTGG
AGTAATGCCGCATACGCTATGGCAACAAACATGACCGCTGCTTTCTCTCAATATGGTTTCTGTACTGCTA
TTCGTGGCGCAGAGGGTGGTGGTAAAGTAGAAGGCTTACCAACGCACATATTTACGAGTGATGATGGCGA
TCCAGATCTTAAATGTCCAACAGAAATTGGCATTACAGACCGTCGTGAGGCCGAGCTAAGCCAGTTAGGT
TTCTTGCCTTTATGTCACTATAAAAACACTGATTATGCTGTTTTCTTTGGTGGCCAAAGCTGTCAAAAAC
CAAAAATCTACTCAACACCTGATGCAACCGCTAATGCTGCCATTTCAGCACGCTTACCTTACTTAATGGC
GACTTCTCGTTTTGCTCATTACCTTAAAGTAATGGCGCGCGATAAAATTGGTAGCTTTATGGAAGCCGAA
GACGTTGAATCATGGTTAAACCGTTGGATTCTGTCTTATGTAAATGCGACAGAGGGCGGTGGTCAAGATA
TTAGAGCACGTTACCCTCTTGCTGATGCGAAAGTATCTGTAAAAGAGATCCCAGGACAACCTGGTGCTTA
TAACGCTGTTGCTTGGCTTAAACCTTGGTTACAAATGGAAGAGCTTACTTCTTCTTTACGCCTTGTAGCT
AAAATCCCAGAGATCGGTTAA