SecReT6
Protein ID: 315123157
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0214
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]239867..241393 [+]
Producthypothetical protein
NoteTssC
UniProt IDE6RQQ0
KEGG IDpsm:PSM_B0214
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-159, Aligned region: 67..500
Protein Sequence: 508 a.a.     [Download]
>gi|315123157|ref|YP_004065163.1| hypothetical protein PSM_B0214 [Pseudoalteromonas sp. SM9913]
MNHEEFSFINQDFTFQQKSQSRISDNDALLDRFLNEKNLDKALLLWLEGSSDSPLSWNKESLSPYLQRVI
IELDQLISSQLNHIIHAKSFQNLEASWRNLWWLLLQTEQQDKEKKVKVKLLNCDWPTLSKDVNKAIDFDQ
STFFQLLYQNEFDSAGGEPFGIVIGDYEISNGCSAGTIYNDIDTIKEVSRTAAAAFSPFICSASANLFGA
DSFSDLGYYSDLFNHFEQPEYIKWQSFRKMEEARFMGFTLPHVLVRPPYANDGKRHQEFYFKEQIINPET
DMLWGNAAYQFVSTIIRAYCDSGWFGHIRGIEPGKVSKGLVTGLARDSFANDTYQKEAKPPLDLLVTSKF
EKQFSELGFIPASSVTNTEHIVFYSNASVQKTKNYDSSAANINARLSSMLQYILCVSRFAHYLKLLARDR
VGSYSTAQACERDLQAWINNYTTASDSASEHIRSKYPLSNAKIKVSENKANPGHYFSVLQLQPHFQLDQM
VSSIKLITELSPHHKIKE
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|315122943|ref|NC_014800.1|:239867-241393 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
ATGAATCACGAAGAGTTTTCATTTATCAATCAAGACTTCACTTTTCAACAAAAGTCGCAGTCTCGAATAA
GTGATAATGACGCTTTACTCGATAGGTTTTTGAACGAAAAAAACCTAGATAAAGCGTTATTATTATGGCT
TGAAGGCTCTTCTGATTCTCCACTTTCTTGGAATAAGGAGTCATTGAGTCCTTATTTACAGCGTGTGATC
ATTGAACTCGATCAACTGATTTCTTCACAACTCAATCATATAATTCATGCAAAAAGCTTTCAAAATTTAG
AAGCTAGTTGGCGAAATCTATGGTGGCTATTATTACAAACAGAGCAACAAGACAAAGAAAAAAAAGTAAA
AGTTAAATTGCTTAATTGTGACTGGCCAACGCTCTCAAAAGACGTAAATAAAGCGATAGATTTCGATCAA
AGTACGTTTTTTCAATTACTCTATCAAAACGAATTTGACAGTGCCGGCGGCGAGCCCTTTGGTATTGTGA
TTGGTGATTATGAAATTAGTAATGGTTGCTCAGCGGGCACTATTTATAACGATATAGATACGATTAAAGA
AGTGTCAAGAACGGCTGCCGCCGCATTTTCTCCTTTTATATGTTCAGCATCGGCTAACTTATTTGGCGCA
GATAGCTTTTCAGATTTAGGTTATTACTCTGATTTATTTAATCATTTTGAGCAGCCTGAATATATAAAAT
GGCAAAGCTTTAGAAAAATGGAAGAAGCTAGATTCATGGGTTTTACACTTCCTCATGTGCTAGTTAGGCC
GCCTTATGCTAATGACGGTAAGCGCCATCAAGAATTCTATTTCAAAGAACAAATTATTAATCCAGAAACA
GATATGCTGTGGGGAAATGCAGCCTATCAATTTGTATCAACAATAATCAGAGCTTACTGCGATAGCGGCT
GGTTTGGGCATATACGTGGTATAGAGCCAGGGAAAGTGTCAAAAGGCTTAGTCACAGGGCTAGCTCGCGA
TAGTTTTGCTAATGATACTTATCAAAAAGAAGCCAAGCCGCCACTGGATTTGTTAGTAACCAGTAAGTTT
GAAAAGCAATTTTCTGAACTCGGTTTTATCCCAGCCTCTTCGGTCACAAATACCGAACATATTGTTTTTT
ACAGTAATGCGTCGGTTCAAAAGACAAAAAATTACGATTCAAGCGCTGCTAATATCAATGCGCGCTTATC
GTCTATGTTGCAATACATTTTATGTGTATCGCGCTTTGCGCACTATTTAAAATTATTGGCCCGAGACCGT
GTAGGCTCTTACAGCACGGCTCAAGCGTGTGAAAGAGATTTACAAGCGTGGATCAATAACTACACAACCG
CGTCAGACTCTGCGTCTGAGCACATTAGAAGTAAATACCCACTCAGTAATGCAAAAATAAAAGTAAGTGA
AAACAAGGCTAATCCGGGTCATTACTTTTCGGTTTTGCAGTTACAGCCTCATTTTCAGTTAGACCAAATG
GTCTCGAGTATTAAGTTAATAACAGAGCTCAGTCCTCATCATAAAATAAAGGAATAG