SecReT6
Protein ID: 315123158
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0215
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]241396..242175 [+]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDE6RQQ1
KEGG IDpsm:PSM_B0215
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.50E-26, Aligned region: 136..250
Protein Sequence: 259 a.a.     [Download]
>gi|315123158|ref|YP_004065164.1| virulence protein, SciE type [Pseudoalteromonas sp. SM9913]
MKKIHSLIREGKLADALLCCATELQDEPLNFDIRSLYSELLCINGELEKADKQLDFMVQKNPEFAVGAVN
LRHLIRAQQSRVDFYQGKGIPKLFHEANELDTLFLKMHVALLEGETSEAATLAKQMEALRLESVDDEHSA
IRDLDDSLSPYLEVLGTNGEFYLANFNEIEALKVEPVTSLLESIWLRVEITIKDGPSGTAHLPLVYANSN
TELEKLGQVSDWDELQDEFIVGKGMKMLFVNDEAITIPSLKINAVETAE
 
Nucleotide Sequence: 780 bp     [Download]
>gi|315122943|ref|NC_014800.1|:241396-242175 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
ATGAAAAAAATACACAGTTTAATTCGCGAGGGAAAACTTGCTGATGCTTTATTATGTTGCGCTACAGAGT
TGCAAGATGAGCCTTTAAATTTTGATATTAGAAGTCTTTATTCTGAATTACTTTGCATTAACGGTGAACT
TGAAAAAGCAGATAAACAGCTAGATTTTATGGTGCAAAAGAACCCTGAATTTGCTGTAGGTGCGGTTAAC
CTTAGGCATTTAATTCGCGCACAACAATCGCGTGTAGATTTTTATCAAGGTAAGGGTATTCCTAAACTCT
TTCATGAAGCTAATGAGCTAGACACCTTGTTCTTAAAAATGCACGTAGCCCTACTTGAAGGCGAAACATC
TGAAGCGGCAACGCTTGCAAAACAAATGGAAGCACTTCGTCTTGAAAGCGTTGATGATGAGCATTCAGCA
ATTAGAGATTTAGATGATAGCTTAAGCCCATATTTAGAAGTGCTAGGCACGAATGGCGAGTTTTACCTTG
CAAACTTTAATGAAATTGAAGCATTAAAAGTAGAACCTGTAACGTCTTTATTAGAGAGCATCTGGTTACG
CGTTGAGATCACTATCAAAGACGGTCCGTCAGGCACGGCACATTTACCGCTGGTTTATGCAAACTCAAAT
ACTGAGCTGGAAAAGTTAGGTCAGGTTTCTGATTGGGATGAGCTACAAGATGAGTTTATTGTAGGTAAAG
GAATGAAAATGTTATTTGTCAACGATGAAGCAATCACTATTCCTAGTCTAAAAATCAACGCCGTTGAAAC
AGCAGAGTAA