SecReT6
Protein ID: 315123159
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0216
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]242191..242676 [+]
Producthypothetical protein
NoteTssE
UniProt IDE6RQQ2
KEGG IDpsm:PSM_B0216
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.70E-19, Aligned region: 35..139
Protein Sequence: 161 a.a.     [Download]
>gi|315123159|ref|YP_004065165.1| hypothetical protein PSM_B0216 [Pseudoalteromonas sp. SM9913]
MIEHKQQLQASILDRLIDDEPDFQDAPSRTEGISISELRKNVRRDIEALLNARIQWHTWPSQYAELSTSC
LSYGLPDFSSMSVSSHEGRALLCETVRNTILKFEPRFIEVEVFTDDEVPVNRVLNLRINALLYADPEPEF
ISFDSEVEPVNLGMKIIEASL
 
Nucleotide Sequence: 486 bp     [Download]
>gi|315122943|ref|NC_014800.1|:242191-242676 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
ATGATTGAACATAAGCAGCAACTCCAAGCATCTATTTTAGATAGGCTCATTGACGATGAGCCTGACTTTC
AAGATGCGCCTTCTCGTACTGAGGGGATCAGCATTAGTGAGCTGAGAAAAAATGTGCGTAGAGACATAGA
AGCGCTGCTAAATGCTCGAATTCAGTGGCATACCTGGCCATCACAATATGCTGAGTTGTCGACTTCGTGT
TTATCATATGGTTTGCCTGACTTTTCGAGTATGTCTGTAAGCTCACACGAAGGGCGTGCACTTTTATGCG
AAACCGTAAGAAATACAATTTTAAAATTTGAACCGCGGTTTATTGAGGTAGAAGTGTTTACCGATGATGA
AGTACCCGTGAACAGAGTATTAAACCTAAGGATTAACGCCTTGTTGTATGCCGATCCAGAACCTGAATTT
ATCAGCTTTGATTCTGAAGTTGAGCCGGTTAATTTAGGTATGAAGATTATTGAGGCCTCTTTATGA