SecReT6
Protein ID: 315123160
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0217
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]242673..244499 [+]
Producthypothetical protein
NoteTssF
UniProt IDE6RQQ3
KEGG IDpsm:PSM_B0217
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-188, Aligned region: 5..608
Protein Sequence: 608 a.a.     [Download]
>gi|315123160|ref|YP_004065166.1| hypothetical protein PSM_B0217 [Pseudoalteromonas sp. SM9913]
MNDELLKYYNRELAFVRHMGKDFSEKYPKVAGRLKLSDDHIEDPHVSRLIESFAFLTANIRQKLDDSFPE
LTDALLGQMLPDYQAPIPSMSVVKLEAENLSTTGVVIPRGSEVETNVESMKQCKFQTCYETYLWPVEITS
AQFDNSPFVAPKPRWHEKAKSIFKLELTGEYPGVSLAETGLEKLRLFINGQWHHTLKVYELLFKHAIGIA
FDNGEEGIKYLSKNQLKAVGFDANEAVVPYSQRSSAGYRLLVENFTFPEKFRFVELENIRSSLPKKSNKC
SVYIYLDSESTELEKQVDKNMFLMGCTPIINMFEQELEPIRPELSEYEYQLTPRYMDSEISEVIGISEVI
AFDHKGNKQIVCPFYGQTHPRYQGHDDLFWHIRRETASWAGGYVESGTESFLSLVDARFENSAMDYAEGN
TVLTVRANCSNRNLPASMPFGDDELGLLMPERGDVIKKIRCLIPFTHAVRPILADATRWQLVNHLTLDAF
SGDDACNKLKEVLRLYDFRASPQTKGLIDNIYRVIVEPATARVVQKGRVSFATGSEIEITFANDDFSGSG
MFFFASILDHFFAQFAAINSFTRVSLRLKEQEQVYYQWPARVGESPLI
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|315122943|ref|NC_014800.1|:242673-244499 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
ATGAACGATGAGTTATTAAAGTACTACAACCGCGAACTAGCGTTTGTTCGCCACATGGGTAAAGACTTTT
CTGAAAAGTACCCTAAAGTTGCTGGGCGATTAAAGTTAAGCGATGACCATATTGAAGACCCTCATGTATC
TAGGCTAATCGAATCGTTCGCATTTTTAACTGCTAATATTAGGCAAAAACTTGATGACAGCTTTCCTGAG
CTAACTGATGCTCTATTGGGACAGATGCTGCCAGACTACCAAGCGCCTATCCCTTCTATGTCGGTGGTAA
AATTAGAAGCTGAAAATCTGTCCACCACGGGTGTGGTCATTCCAAGAGGCAGTGAAGTAGAAACCAATGT
TGAGTCGATGAAGCAATGTAAGTTTCAAACCTGTTACGAAACTTATTTATGGCCGGTTGAGATCACAAGT
GCCCAATTTGATAATAGTCCGTTTGTTGCCCCTAAGCCTCGTTGGCATGAAAAAGCTAAGTCAATTTTCA
AACTTGAGCTAACCGGTGAATATCCGGGTGTATCATTAGCTGAAACCGGGCTGGAAAAATTACGATTATT
TATAAATGGCCAATGGCATCATACGCTTAAAGTGTATGAACTATTATTTAAACACGCTATTGGTATTGCT
TTTGATAATGGTGAAGAGGGTATAAAGTACCTTTCTAAAAACCAGTTAAAAGCCGTAGGCTTTGATGCAA
ATGAAGCGGTGGTGCCCTATTCGCAGCGCTCAAGTGCTGGTTATCGGTTACTGGTGGAAAACTTTACCTT
TCCGGAAAAGTTTCGCTTTGTTGAGCTTGAAAATATTCGTTCATCACTGCCTAAAAAGTCTAACAAATGC
AGTGTGTATATTTATCTTGATTCAGAGTCAACCGAGCTTGAAAAGCAAGTAGACAAAAATATGTTTTTAA
TGGGATGTACACCCATTATCAATATGTTTGAGCAAGAACTAGAACCGATTCGCCCTGAGCTGAGTGAATA
CGAATACCAATTAACACCACGCTATATGGACTCTGAAATCTCAGAGGTGATTGGTATCTCAGAAGTTATT
GCGTTTGATCACAAAGGGAACAAACAAATAGTGTGTCCTTTTTATGGGCAGACTCATCCACGATACCAAG
GCCATGATGATTTATTTTGGCACATCCGCAGAGAAACCGCTTCTTGGGCCGGTGGCTATGTTGAGTCAGG
TACGGAATCGTTTCTATCATTGGTAGATGCACGATTTGAAAATAGCGCTATGGATTATGCTGAAGGGAAC
ACGGTATTAACAGTACGTGCTAATTGCAGTAATCGAAACCTTCCTGCTAGCATGCCCTTTGGAGATGATG
AACTCGGACTTTTAATGCCTGAACGTGGTGATGTAATAAAAAAAATACGTTGTTTAATCCCATTTACTCA
TGCAGTTAGACCGATATTAGCCGATGCAACTCGTTGGCAATTAGTTAATCATTTAACCCTTGATGCGTTT
AGTGGAGATGATGCATGTAACAAGCTTAAAGAAGTGTTACGGCTGTATGACTTTAGAGCTTCACCGCAAA
CAAAAGGCCTTATCGATAATATTTACCGCGTGATTGTAGAACCAGCAACGGCGCGTGTTGTACAAAAAGG
ACGAGTAAGCTTCGCAACGGGAAGCGAAATAGAAATTACCTTTGCCAATGATGATTTTTCGGGAAGTGGT
ATGTTTTTCTTTGCTTCTATCCTCGATCATTTCTTTGCACAATTTGCGGCAATCAATAGTTTCACGCGTG
TTAGTTTAAGGCTCAAAGAACAAGAGCAAGTGTATTATCAATGGCCTGCTCGAGTTGGGGAAAGCCCGTT
AATATGA