SecReT6
Protein ID: 315123161
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0218
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]244463..245485 [+]
Producthypothetical protein
NoteTssG
UniProt IDE6RQQ4
KEGG IDpsm:PSM_B0218
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.40E-72, Aligned region: 19..323
Protein Sequence: 340 a.a.     [Download]
>gi|315123161|ref|YP_004065167.1| hypothetical protein PSM_B0218 [Pseudoalteromonas sp. SM9913]
MACSSWGKPVNMIQHIISQASQVDFYKAVFIIENQLKKHGLEYRYVGYDSSPKQELIKFTATQKFGYPGN
AITKLEQASFEDGLHKVNMQISFMGLTGCSGALPQFYSELVMQRLRYKDTTMRDFYDMFNHRLVSLYYRA
WKKYKPSLNHVNKDKNKDPYTQILGLLSGGYNDHQLHFSGLYSRKIRNAFDLKSVLSSYLGCDVVIKQMV
GKWHDLKPQEQTCLASERLYEGQHARLGVDTVIGKKIWDISSNIEIHISTTDIDKAKSLLPKGKLFELAT
KIVKDYAGNAISFRLIIESDFQQLDAVQLSKRECQLGANSFLMASKNTPKFNPIKLSFKG
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|315122943|ref|NC_014800.1|:244463-245485 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
ATGGCCTGCTCGAGTTGGGGAAAGCCCGTTAATATGATCCAGCATATTATTTCTCAAGCGTCACAAGTTG
ATTTTTATAAAGCTGTTTTCATTATTGAAAACCAGCTGAAAAAGCATGGCTTAGAGTATCGCTATGTAGG
GTATGACAGTAGCCCAAAGCAAGAGTTAATTAAATTTACCGCAACACAAAAATTTGGTTACCCAGGTAAC
GCTATCACAAAATTAGAGCAAGCTAGCTTTGAAGATGGGTTGCATAAAGTCAACATGCAGATCTCTTTTA
TGGGATTAACGGGTTGCTCAGGTGCTTTACCCCAATTTTACAGCGAGCTGGTGATGCAGCGTCTTCGCTA
TAAAGATACCACCATGCGTGACTTTTACGACATGTTTAATCATCGTTTGGTGTCTTTATATTATCGAGCG
TGGAAAAAATATAAGCCGTCTTTAAATCATGTGAACAAAGATAAAAACAAAGACCCATATACACAAATAT
TGGGACTTTTAAGTGGCGGCTATAATGATCATCAGCTGCATTTTTCTGGCTTGTATAGCCGAAAAATTCG
CAACGCTTTTGATTTAAAAAGTGTATTGAGCTCTTACCTTGGTTGTGATGTTGTCATCAAACAAATGGTA
GGAAAGTGGCATGATTTGAAGCCACAAGAACAAACCTGTTTAGCAAGTGAGCGCCTATACGAGGGACAAC
ATGCTCGCTTAGGCGTTGATACCGTAATAGGTAAAAAGATATGGGATATTTCTTCTAATATTGAGATTCA
TATCAGCACTACTGATATTGATAAAGCAAAATCCTTGTTACCGAAAGGCAAGTTATTTGAGTTAGCTACC
AAAATTGTAAAAGATTATGCGGGCAATGCGATTTCATTTCGACTTATCATCGAATCAGATTTTCAACAAC
TTGATGCGGTGCAGTTGTCTAAACGGGAATGCCAACTTGGCGCTAATAGCTTTTTAATGGCGAGTAAAAA
CACCCCTAAATTTAACCCTATTAAGTTATCGTTTAAAGGATAA