SecReT6
Protein ID: 315123162
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0219
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]245509..248127 [+]
ProductATPase
NoteTssH
UniProt IDE6RQQ5
KEGG IDpsm:PSM_B0219
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.20E-42, Aligned region: 222..243
AAA_2 [PF07724], Evalue: 9.20E-42, Aligned region: 600..767
AAA [PF00004], Evalue: 3.90E-20, Aligned region: 222..353
AAA [PF00004], Evalue: 3.90E-20, Aligned region: 605..723
ClpB_D2-small [PF10431], Evalue: 9.20E-14, Aligned region: 772..850
AAA_16 [PF13191], Evalue: 4.70E-13, Aligned region: 199..247
AAA_16 [PF13191], Evalue: 4.70E-13, Aligned region: 265..300
AAA_16 [PF13191], Evalue: 4.70E-13, Aligned region: 449..492
AAA_16 [PF13191], Evalue: 4.70E-13, Aligned region: 573..628
AAA_16 [PF13191], Evalue: 4.70E-13, Aligned region: 668..697
AAA_5 [PF07728], Evalue: 8.20E-13, Aligned region: 222..300
AAA_5 [PF07728], Evalue: 8.20E-13, Aligned region: 461..461
AAA_5 [PF07728], Evalue: 8.20E-13, Aligned region: 604..724
Sigma54_activat [PF00158], Evalue: 1.30E-08, Aligned region: 218..302
Sigma54_activat [PF00158], Evalue: 1.30E-08, Aligned region: 593..721
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 221..308
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 346..414
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 601..635
AAA_19 [PF13245], Evalue: 3.20E-07, Aligned region: 222..246
AAA_19 [PF13245], Evalue: 3.20E-07, Aligned region: 597..628
AAA_25 [PF13481], Evalue: 2.50E-06, Aligned region: 222..293
AAA_25 [PF13481], Evalue: 2.50E-06, Aligned region: 600..626
AAA_25 [PF13481], Evalue: 2.50E-06, Aligned region: 666..688
IstB_IS21 [PF01695], Evalue: 3.00E-06, Aligned region: 216..281
IstB_IS21 [PF01695], Evalue: 3.00E-06, Aligned region: 604..638
IstB_IS21 [PF01695], Evalue: 3.00E-06, Aligned region: 715..735
AAA_14 [PF13173], Evalue: 7.10E-06, Aligned region: 222..334
AAA_14 [PF13173], Evalue: 7.10E-06, Aligned region: 601..695
Zeta_toxin [PF06414], Evalue: 1.50E-05, Aligned region: 217..243
Zeta_toxin [PF06414], Evalue: 1.50E-05, Aligned region: 337..394
Zeta_toxin [PF06414], Evalue: 1.50E-05, Aligned region: 596..645
Arch_ATPase [PF01637], Evalue: 2.00E-05, Aligned region: 201..247
Arch_ATPase [PF01637], Evalue: 2.00E-05, Aligned region: 433..519
Arch_ATPase [PF01637], Evalue: 2.00E-05, Aligned region: 597..643
AAA_17 [PF13207], Evalue: 2.20E-05, Aligned region: 222..324
AAA_17 [PF13207], Evalue: 2.20E-05, Aligned region: 605..642
NACHT [PF05729], Evalue: 6.70E-05, Aligned region: 222..250
NACHT [PF05729], Evalue: 6.70E-05, Aligned region: 402..438
NACHT [PF05729], Evalue: 6.70E-05, Aligned region: 605..629
DUF2075 [PF09848], Evalue: 6.80E-05, Aligned region: 222..324
DUF2075 [PF09848], Evalue: 6.80E-05, Aligned region: 422..485
DUF2075 [PF09848], Evalue: 6.80E-05, Aligned region: 603..639
TIP49 [PF06068], Evalue: 0.00022, Aligned region: 222..258
TIP49 [PF06068], Evalue: 0.00022, Aligned region: 272..302
TIP49 [PF06068], Evalue: 0.00022, Aligned region: 566..640
AAA_18 [PF13238], Evalue: 0.00029, Aligned region: 222..287
AAA_18 [PF13238], Evalue: 0.00029, Aligned region: 476..537
AAA_18 [PF13238], Evalue: 0.00029, Aligned region: 606..639
Clp_N [PF02861], Evalue: 0.00031, Aligned region: 27..75
RNA_helicase [PF00910], Evalue: 0.00069, Aligned region: 223..245
RNA_helicase [PF00910], Evalue: 0.00069, Aligned region: 605..628
RNA_helicase [PF00910], Evalue: 0.00069, Aligned region: 705..723
DUF258 [PF03193], Evalue: 0.00089, Aligned region: 216..243
DUF258 [PF03193], Evalue: 0.00089, Aligned region: 432..461
DUF258 [PF03193], Evalue: 0.00089, Aligned region: 589..622
SRP54 [PF00448], Evalue: 0.001, Aligned region: 222..249
SRP54 [PF00448], Evalue: 0.001, Aligned region: 428..454
SRP54 [PF00448], Evalue: 0.001, Aligned region: 603..638
CorA [PF01544], Evalue: 0.0017, Aligned region: 37..71
CorA [PF01544], Evalue: 0.0017, Aligned region: 371..519
UPF0079 [PF02367], Evalue: 0.0019, Aligned region: 222..244
UPF0079 [PF02367], Evalue: 0.0019, Aligned region: 593..633
ArsA_ATPase [PF02374], Evalue: 0.002, Aligned region: 223..247
ArsA_ATPase [PF02374], Evalue: 0.002, Aligned region: 410..565
ArsA_ATPase [PF02374], Evalue: 0.002, Aligned region: 603..635
AAA_30 [PF13604], Evalue: 0.0027, Aligned region: 209..246
AAA_30 [PF13604], Evalue: 0.0027, Aligned region: 601..636
NTPase_1 [PF03266], Evalue: 0.0041, Aligned region: 222..247
NTPase_1 [PF03266], Evalue: 0.0041, Aligned region: 604..631
AAA_29 [PF13555], Evalue: 0.0046, Aligned region: 215..238
AAA_29 [PF13555], Evalue: 0.0046, Aligned region: 600..615
AAA_10 [PF12846], Evalue: 0.0061, Aligned region: 222..248
AAA_10 [PF12846], Evalue: 0.0061, Aligned region: 286..308
AAA_10 [PF12846], Evalue: 0.0061, Aligned region: 411..456
AAA_10 [PF12846], Evalue: 0.0061, Aligned region: 601..635
PhoH [PF02562], Evalue: 0.008, Aligned region: 205..244
PhoH [PF02562], Evalue: 0.008, Aligned region: 593..631
T2SE [PF00437], Evalue: 0.0082, Aligned region: 207..244
T2SE [PF00437], Evalue: 0.0082, Aligned region: 599..639
ResIII [PF04851], Evalue: 0.0084, Aligned region: 210..244
ResIII [PF04851], Evalue: 0.0084, Aligned region: 293..303
ResIII [PF04851], Evalue: 0.0084, Aligned region: 572..627
Protein Sequence: 872 a.a.     [Download]
>gi|315123162|ref|YP_004065168.1| ATPase [Pseudoalteromonas sp. SM9913]
MSTMTLNKLVEKLSPDCRKSLEAAVAICNSRSHFTVELEHWLLAMIEQQLDDVRLIFGSFDIDIDQVKQD
LNQSLESFKTGSDSSPSLSVHVTTLLRQSWLSTSIEFTDEQIRSAYVIYTLTKDDTLSSLVTRCSKLFNN
IEPGQLLHAWPEIVAQSQERNTANVTAATPANGSSKTPSLDQFTVDLTAQAKAGKIDPILGRDFEIRQMV
DILTRRRQNNPILTGEAGVGKTAVVEGLALRIAQKDVPAVLQNVKLHSLDLALLQAGAGMKGEFENRLKS
LINEVKNAVDPVILFIDEAHTMIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKFFEKDAALTR
RFQVVKVEEPTPEKAVAMLRGLVPVMEKHHKVFISEQALESAVHLSHRYITARQLPDKAVALLDTACARV
AMSQASTPNAIEQLMNRLSEIEAQVLMLNREQKTGLDHSEQLSALKSELVEIEQQLEPLNEQFNVEKGIV
AELNQALESINTNDADSSAEVLEQLKESKLKLASYEHNMVHWQVDEELIAQVISDWTGIPVGKMHEDEIH
GILNLAAQMKQRVVGQDHALELMAKVVQTSRAQLADESRPNGIFMLAGPSGVGKTETALSLAQEVYGSED
NVTVINMSEFKEEHKVSLLLGSPPGYVGYGEGGILTEAVRRKPYSVVLLDEMEKAHPGVQDIFYQVFDKG
TIKDGEGRDIDFKNTIIIMTSNVGTDTTMSLFEDEESKPSIKGLLKALQDDLLGAFKPAFLGRINVIPYI
PLSDEILTQIAALQISKIIKRVKKHYDAQLTYNDDVIEHIIANCQNAGSGARNIHTILQNKVLPLLSEIL
LSSMVEGEKVTSISLLIKDNEFDVELTKVNSK
 
Nucleotide Sequence: 2619 bp     [Download]
>gi|315122943|ref|NC_014800.1|:245509-248127 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
ATGTCAACGATGACATTAAATAAATTAGTTGAAAAACTAAGTCCAGATTGTAGAAAAAGCTTAGAGGCAG
CTGTTGCAATATGTAATAGCCGCAGCCATTTTACGGTTGAATTAGAGCATTGGTTGTTAGCCATGATTGA
GCAGCAACTAGACGATGTTAGACTCATATTCGGTTCTTTCGATATTGATATTGATCAGGTGAAGCAAGAT
TTAAACCAATCACTAGAGTCATTTAAAACGGGCAGTGATTCATCGCCTAGCCTATCAGTGCATGTGACTA
CATTATTAAGGCAGTCATGGTTAAGTACCAGTATAGAATTCACCGATGAGCAAATTCGCAGTGCTTATGT
TATTTATACGCTAACAAAAGACGATACGCTTTCAAGTTTAGTAACGCGCTGTAGCAAATTGTTTAATAAC
ATAGAGCCAGGCCAACTGTTACATGCATGGCCTGAAATTGTTGCACAATCGCAAGAGCGAAATACCGCCA
ATGTAACTGCTGCAACACCTGCAAATGGTTCATCTAAAACACCGAGTTTAGATCAATTTACAGTTGATTT
AACCGCTCAAGCAAAAGCGGGGAAAATAGACCCTATTCTAGGTCGTGATTTTGAAATACGTCAAATGGTT
GATATTTTAACTAGACGTCGTCAAAACAACCCAATCTTGACGGGTGAAGCGGGTGTAGGTAAAACCGCTG
TGGTTGAAGGACTTGCCCTAAGAATTGCCCAAAAAGACGTACCTGCAGTATTACAAAACGTTAAGTTGCA
CAGCCTAGATTTGGCTTTGCTTCAAGCAGGTGCGGGCATGAAAGGTGAGTTTGAAAATCGCTTAAAGTCG
TTAATTAACGAAGTTAAAAACGCTGTTGACCCTGTGATTCTTTTTATAGATGAAGCTCACACTATGATTG
GTAGTGGCGGACAAGCGGGTCAAAACGATGCGGCTAACTTACTAAAACCTGCTTTAGCAAGAGGGGAATT
ACGTACTATTGCAGCAACAACGTGGGCTGAATATAAAAAGTTTTTTGAAAAGGATGCTGCACTAACACGT
CGTTTCCAAGTGGTAAAGGTTGAAGAGCCAACGCCAGAAAAAGCGGTTGCTATGCTACGTGGTTTAGTTC
CTGTTATGGAAAAGCATCATAAAGTTTTTATTTCAGAGCAAGCACTTGAAAGTGCGGTGCATCTATCGCA
CAGATACATTACTGCCAGGCAACTTCCCGATAAAGCAGTTGCATTGTTAGATACGGCCTGTGCTCGTGTT
GCTATGAGCCAAGCATCGACACCTAATGCGATTGAGCAGTTAATGAATAGACTTAGTGAAATTGAAGCGC
AAGTTTTAATGTTAAATCGTGAGCAAAAAACCGGTTTAGATCATAGCGAACAATTATCAGCACTTAAATC
TGAACTAGTTGAGATTGAACAGCAACTTGAACCATTAAATGAGCAGTTCAACGTTGAAAAAGGCATCGTT
GCAGAATTAAACCAAGCGCTTGAATCGATTAACACCAACGATGCAGACTCTTCTGCTGAAGTACTTGAGC
AGTTAAAAGAAAGTAAGCTTAAGCTAGCCTCGTACGAACATAACATGGTGCATTGGCAAGTTGATGAAGA
GCTGATTGCACAGGTTATTTCTGATTGGACTGGTATTCCTGTTGGTAAAATGCATGAAGATGAAATTCAT
GGCATTTTAAATTTAGCTGCGCAAATGAAACAACGCGTAGTTGGCCAAGATCATGCGCTTGAACTCATGG
CTAAAGTAGTACAAACCTCTCGTGCTCAGCTTGCAGATGAAAGTCGCCCTAATGGTATATTTATGCTGGC
AGGCCCAAGCGGAGTGGGTAAAACAGAGACCGCGCTTTCACTAGCACAAGAAGTATATGGCAGTGAAGAT
AACGTAACAGTTATTAATATGTCTGAGTTTAAAGAAGAGCATAAAGTGTCATTACTACTTGGCTCACCTC
CAGGTTATGTTGGTTATGGCGAAGGCGGTATTTTAACCGAAGCAGTAAGAAGAAAACCATATAGTGTGGT
GCTGCTAGATGAAATGGAAAAAGCCCATCCAGGCGTGCAAGATATTTTCTATCAAGTATTCGATAAAGGC
ACCATAAAAGACGGTGAAGGCCGAGATATCGACTTTAAAAATACCATCATTATTATGACCTCAAATGTGG
GTACTGATACCACAATGAGCTTATTTGAAGATGAAGAAAGTAAGCCAAGTATTAAAGGCTTATTAAAAGC
ATTACAAGATGATTTATTAGGGGCATTTAAGCCTGCATTTTTAGGACGAATTAACGTTATTCCATATATT
CCGTTAAGTGATGAAATTCTTACCCAGATTGCTGCGTTGCAAATTAGTAAAATAATTAAGCGTGTTAAAA
AGCACTATGATGCGCAATTAACGTATAACGATGATGTGATTGAGCACATTATTGCAAATTGTCAAAATGC
CGGATCGGGTGCACGAAATATTCACACCATATTACAGAATAAAGTACTACCTCTATTGTCTGAGATCTTG
CTTTCAAGCATGGTTGAAGGTGAAAAAGTAACATCTATCTCATTGTTAATTAAAGATAATGAGTTCGATG
TTGAATTAACTAAAGTTAATTCAAAATAA