SecReT6
Protein ID: 315123164
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0221
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]248901..250754 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDE6RQQ7
KEGG IDpsm:PSM_B0221
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.10E-63, Aligned region: 30..332
Phage_base_V [PF04717], Evalue: 3.50E-27, Aligned region: 375..468
DUF2345 [PF10106], Evalue: 0.00072, Aligned region: 538..605
Protein Sequence: 617 a.a.     [Download]
>gi|315123164|ref|YP_004065170.1| Rhs element Vgr protein [Pseudoalteromonas sp. SM9913]
MQKATQDKNVIQISTPVGKDALYLTRFVAQEAMSDLFVMSVNMYTIGQQIAHEDLVGKPVSIKVKNAEGG
GERFYHGIVSQLVSNGSRTADVDEQKNYIDYQATIVPFAASMRNRKNSRIFQKKTIKDIFADLFGQHNVA
FSDKTSKTYPKYEYCVQYQESDFDFIQRLLQSEGIFYFFEHTKSNHTLVLADDITAYEMCGEAKVVHSTG
HLSESHVSRWQGGLSLAPGSFKRLGYDFKQPSRYPDAEQANAELPTQSVSEIFEYTAEAECHPRAANLAS
VQLESLQRDMKLSSGRSDCRSFSVGKLFSFKKHEDPRLEGKTFAITSMMTSIVVPNQSGAAQASSEEVYS
NHFECVPKDIPYRAQVSKKKPVINGVQTAIVTGDSADEIMIDQYGRVKVQFDWDREGKKDSKSSCWIRVA
QNWAGKKWGAFFFPRVGQEVLVDFINGDPDQPIISGAVYNADLMPPYALPGEKTQSGIKTRSTKEGGADN
FNELRFEDKKGSELVYMQAEKDKQLYVKNDQNEKIDNDRNVEILNNDNLKVTANRVAEMGENDTLKVGKT
LNIEAGDEIVIKTGSAQIKMSSSGNITIEGTNIDIKGSNVKVDGSAITLSAGVIKLN
 
Nucleotide Sequence: 1854 bp     [Download]
>gi|315122943|ref|NC_014800.1|:248901-250754 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
ATGCAAAAAGCAACACAAGATAAAAACGTAATTCAAATTAGTACTCCTGTTGGTAAAGATGCCCTTTATT
TAACACGCTTCGTTGCTCAAGAAGCCATGTCAGATTTGTTTGTTATGTCGGTCAATATGTATACCATAGG
CCAACAAATTGCACATGAAGATCTGGTTGGCAAGCCTGTTTCTATCAAGGTAAAAAATGCCGAGGGTGGG
GGAGAGCGTTTTTATCACGGTATCGTGAGTCAGCTTGTTTCTAACGGAAGCCGTACGGCGGATGTTGATG
AGCAAAAAAATTACATTGATTATCAAGCTACCATTGTGCCTTTTGCCGCTTCTATGCGTAATCGTAAAAA
CAGTCGCATTTTCCAAAAGAAAACAATTAAAGATATATTCGCTGATTTGTTTGGCCAACACAATGTGGCT
TTTTCAGATAAAACCAGTAAAACCTACCCCAAATACGAATACTGTGTGCAATACCAAGAGTCAGATTTTG
ACTTTATCCAACGCTTATTACAAAGTGAGGGGATTTTTTACTTCTTTGAGCATACAAAAAGTAATCATAC
ATTAGTTTTAGCAGATGATATTACAGCATATGAAATGTGTGGTGAGGCTAAAGTTGTTCATTCAACTGGC
CATTTAAGTGAGTCTCATGTTTCGCGTTGGCAGGGCGGATTAAGCTTAGCGCCAGGTAGTTTCAAACGTT
TGGGCTACGATTTTAAACAGCCATCACGTTACCCTGATGCAGAGCAAGCAAACGCAGAATTACCGACCCA
ATCGGTATCAGAAATTTTTGAATATACAGCTGAAGCAGAGTGTCATCCCCGCGCGGCTAATTTGGCATCA
GTTCAACTAGAGTCACTGCAAAGAGACATGAAGCTCTCGAGCGGGCGCAGTGACTGCCGCTCATTCTCTG
TTGGTAAACTGTTTAGTTTCAAAAAACATGAAGACCCACGCCTTGAAGGTAAAACCTTTGCTATCACCTC
GATGATGACGTCGATTGTGGTACCAAACCAATCAGGCGCTGCACAAGCATCGAGTGAAGAAGTGTATTCT
AACCACTTTGAATGTGTGCCAAAAGACATTCCATACAGAGCGCAAGTGAGCAAAAAGAAACCGGTTATCA
ACGGCGTACAAACAGCCATAGTAACGGGTGATAGCGCCGATGAAATTATGATTGACCAATATGGCCGCGT
TAAGGTGCAATTTGATTGGGATCGTGAAGGTAAAAAAGACTCTAAAAGTTCATGCTGGATCCGAGTTGCA
CAAAATTGGGCTGGCAAAAAGTGGGGCGCCTTTTTCTTTCCCCGCGTAGGTCAAGAAGTTCTGGTTGATT
TTATTAATGGCGACCCAGATCAACCTATTATAAGCGGTGCTGTTTATAATGCAGACCTAATGCCTCCGTA
CGCATTACCTGGTGAAAAAACGCAAAGTGGTATTAAGACTCGCTCAACTAAAGAAGGTGGAGCAGATAAC
TTTAATGAGCTGCGCTTTGAGGATAAAAAAGGCAGCGAGCTTGTGTATATGCAAGCCGAAAAAGATAAAC
AGCTTTACGTTAAAAACGATCAAAACGAAAAAATAGATAACGACCGTAATGTTGAAATCCTCAATAACGA
TAATCTCAAAGTCACAGCTAACCGTGTTGCTGAAATGGGTGAAAATGACACCTTAAAAGTCGGTAAAACA
CTTAATATTGAAGCGGGTGACGAAATAGTGATAAAAACAGGCTCTGCGCAAATTAAAATGAGCAGTAGTG
GCAATATTACTATTGAAGGTACAAACATTGATATTAAAGGCAGTAATGTAAAAGTAGATGGCAGTGCCAT
TACCTTATCTGCTGGTGTAATTAAGTTAAATTAA