SecReT6
Protein ID: 317048710
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2501
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2727626..2729548 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDE6WET9
KEGG IDpao:Pat9b_2501
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-76, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 2.40E-25, Aligned region: 364..457
Gp5_C [PF06715], Evalue: 0.0014, Aligned region: 500..521
Gp5_C [PF06715], Evalue: 0.0014, Aligned region: 517..535
Protein Sequence: 640 a.a.     [Download]
>gi|317048710|ref|YP_004116358.1| ImpA family type VI secretion-associated protein [Pantoea sp. At-9b]
MFSRITVQLPTEGLLFWKLSGREALSESFTLQADLLSTDARIDRHALLGKSVTFTLPTQNLLTPRYLNGK
ITRVAVRSEELNGTRYAVYALTVEPDVWPMKRDRNLRIFQSQTVPQIVQTLLKEYNVNVESKLASSYRVW
EYCVQYQESSFDFISRLMELEGIYYWFRHESDKHTLVLCDAADQHQPFSGYATIPYHVAPSGGSTTEEGI
SQWSLAESVTPGMYSTDDYDFRKPNAWMLQARQNPVAPTPGTVDVYDWPGHFVDHSHGEFYTRIRQEVWE
VEHHSVSGTGTATGIAPGYTFGLLDAPHFSDNGNYLTTSADYSFEENSYASGDITASHNINFTVLPTSIT
FRAPPRAPWPKTHGPQTAKVVGPQGESIWTDRYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGFGGV
QIPRVGDEVVVDFINGDPDRPLIIGRVYNEASMPPWALPAAATQMGFLSRTKDGTAETANALRFEDKSGQ
EQLWIQAQKNMDTNVKNDETHSVGGSRTVSVTQDYNGTVSGSHTEATQLAHSQLVGGGFIQRVQGAIVQA
SDSGIRLVAGQSVLELGANGQVTLQCVNFNIDASGTGQINTGGTLDLNLKQPGALPAVEPTPAQIQDAVK
AAFNQGKDNA
 
Nucleotide Sequence: 1923 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2729548-2727626 Pantoea sp. At-9b chromosome, complete genome
ATGTTCTCACGCATCACCGTCCAGCTGCCCACGGAGGGCCTGCTGTTCTGGAAACTCAGCGGGCGTGAAG
CCCTGTCGGAATCATTCACCCTCCAGGCGGATTTGTTGTCGACCGATGCCCGCATCGATCGCCATGCTCT
GCTGGGCAAATCGGTGACCTTTACGCTGCCGACCCAGAACCTGCTCACGCCACGTTACCTCAACGGCAAA
ATCACCCGCGTGGCCGTGCGCAGTGAGGAGCTGAACGGCACGCGCTACGCGGTTTATGCCCTGACCGTCG
AGCCGGATGTGTGGCCGATGAAACGTGATCGTAACCTGCGTATTTTCCAGAGCCAGACCGTGCCGCAAAT
CGTGCAGACGTTGCTGAAAGAGTACAACGTCAACGTCGAATCAAAACTCGCCAGCAGCTACCGGGTGTGG
GAATACTGCGTGCAGTACCAGGAGAGCAGCTTCGATTTTATCAGCCGTCTGATGGAGCTGGAGGGGATCT
ACTACTGGTTCCGCCATGAATCCGATAAGCATACGCTGGTATTGTGCGATGCTGCCGATCAGCACCAGCC
GTTCAGTGGCTATGCCACCATTCCCTACCACGTGGCCCCTTCCGGCGGCAGCACAACGGAAGAGGGGATC
AGCCAGTGGTCGCTGGCCGAGAGCGTGACGCCGGGGATGTACAGCACGGATGACTATGACTTCCGCAAAC
CGAATGCCTGGATGTTACAGGCGCGGCAGAACCCGGTTGCGCCCACGCCGGGCACGGTGGATGTCTACGA
CTGGCCGGGCCATTTTGTTGATCACAGCCACGGCGAGTTTTACACCCGCATCCGCCAGGAAGTCTGGGAA
GTGGAGCATCACAGCGTCAGTGGCACGGGGACGGCGACCGGCATTGCGCCGGGTTACACCTTTGGCCTGC
TCGATGCGCCGCATTTCAGTGATAACGGCAACTATCTCACCACCAGTGCCGACTATAGCTTCGAGGAAAA
CAGCTACGCCAGCGGTGATATTACCGCCTCGCATAACATCAACTTTACCGTTCTGCCGACCTCGATCACT
TTCCGTGCGCCACCCCGTGCGCCATGGCCAAAAACTCACGGTCCACAGACGGCGAAAGTGGTGGGGCCGC
AGGGGGAATCGATCTGGACCGACCGTTATGGCCGGGTCAAGGTGAAGTTTCACTGGGACCGGCTGGCAAA
AGGCGACGATACCAGCTCGTGCTGGGTGCGTGTTTCCAGCGCCTGGGCGGGCCAGGGATTTGGTGGTGTG
CAGATCCCGCGTGTTGGCGACGAAGTGGTGGTGGATTTTATCAATGGTGACCCGGATCGCCCGCTGATCA
TTGGCCGCGTGTATAACGAGGCGAGTATGCCGCCCTGGGCACTGCCAGCGGCGGCGACGCAGATGGGTTT
CCTCAGCCGTACCAAAGATGGCACCGCAGAAACCGCCAATGCACTGCGCTTCGAGGATAAGTCCGGGCAG
GAGCAGTTGTGGATCCAGGCGCAGAAGAACATGGATACCAACGTTAAAAACGACGAAACCCACAGCGTTG
GGGGGTCGCGTACCGTCAGTGTCACCCAGGACTACAACGGCACGGTGTCGGGCAGCCACACCGAGGCGAC
GCAACTGGCCCATTCCCAACTGGTGGGCGGTGGTTTTATCCAGCGTGTGCAGGGGGCGATTGTGCAGGCG
TCCGACAGCGGCATTCGTCTGGTGGCGGGCCAATCGGTGCTGGAATTAGGCGCCAACGGTCAGGTCACAT
TGCAATGCGTGAATTTTAATATCGATGCTTCCGGCACCGGACAGATTAACACTGGCGGTACGCTGGATCT
GAACCTGAAACAACCCGGTGCATTACCCGCAGTGGAACCCACCCCGGCGCAAATCCAGGACGCCGTTAAA
GCGGCATTTAATCAAGGAAAAGATAACGCATGA