SecReT6
Protein ID: 317048712
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2503
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2731041..2733647 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDE6WEU1
KEGG IDpao:Pat9b_2503
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.80E-40, Aligned region: 222..241
AAA_2 [PF07724], Evalue: 4.80E-40, Aligned region: 599..764
AAA [PF00004], Evalue: 1.30E-21, Aligned region: 123..164
AAA [PF00004], Evalue: 1.30E-21, Aligned region: 223..356
AAA [PF00004], Evalue: 1.30E-21, Aligned region: 368..391
AAA [PF00004], Evalue: 1.30E-21, Aligned region: 605..689
ClpB_D2-small [PF10431], Evalue: 1.80E-14, Aligned region: 772..847
AAA_5 [PF07728], Evalue: 2.20E-11, Aligned region: 223..243
AAA_5 [PF07728], Evalue: 2.20E-11, Aligned region: 604..722
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 223..304
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 603..628
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 666..690
AAA_16 [PF13191], Evalue: 2.20E-08, Aligned region: 35..81
AAA_16 [PF13191], Evalue: 2.20E-08, Aligned region: 200..244
AAA_16 [PF13191], Evalue: 2.20E-08, Aligned region: 268..302
AAA_16 [PF13191], Evalue: 2.20E-08, Aligned region: 474..474
AAA_16 [PF13191], Evalue: 2.20E-08, Aligned region: 598..649
Sigma54_activat [PF00158], Evalue: 3.60E-07, Aligned region: 208..239
Sigma54_activat [PF00158], Evalue: 3.60E-07, Aligned region: 604..720
AAA_14 [PF13173], Evalue: 4.50E-06, Aligned region: 224..302
AAA_14 [PF13173], Evalue: 4.50E-06, Aligned region: 329..389
AAA_14 [PF13173], Evalue: 4.50E-06, Aligned region: 603..714
AAA_17 [PF13207], Evalue: 1.10E-05, Aligned region: 223..284
AAA_17 [PF13207], Evalue: 1.10E-05, Aligned region: 604..640
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 222..247
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 473..497
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 594..629
IstB_IS21 [PF01695], Evalue: 1.80E-05, Aligned region: 207..242
IstB_IS21 [PF01695], Evalue: 1.80E-05, Aligned region: 604..625
IstB_IS21 [PF01695], Evalue: 1.80E-05, Aligned region: 714..735
AAA_18 [PF13238], Evalue: 1.80E-05, Aligned region: 223..243
AAA_18 [PF13238], Evalue: 1.80E-05, Aligned region: 606..633
AAA_18 [PF13238], Evalue: 1.80E-05, Aligned region: 795..854
Clp_N [PF02861], Evalue: 2.80E-05, Aligned region: 28..75
Clp_N [PF02861], Evalue: 2.80E-05, Aligned region: 115..133
Clp_N [PF02861], Evalue: 2.80E-05, Aligned region: 310..320
Zeta_toxin [PF06414], Evalue: 3.30E-05, Aligned region: 222..243
Zeta_toxin [PF06414], Evalue: 3.30E-05, Aligned region: 598..644
AAA_19 [PF13245], Evalue: 3.80E-05, Aligned region: 171..213
AAA_19 [PF13245], Evalue: 3.80E-05, Aligned region: 222..247
AAA_19 [PF13245], Evalue: 3.80E-05, Aligned region: 602..626
NACHT [PF05729], Evalue: 0.00012, Aligned region: 223..250
NACHT [PF05729], Evalue: 0.00012, Aligned region: 280..326
NACHT [PF05729], Evalue: 0.00012, Aligned region: 605..631
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 202..237
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 276..306
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 353..397
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 603..644
AAA_29 [PF13555], Evalue: 0.00076, Aligned region: 215..239
AAA_29 [PF13555], Evalue: 0.00076, Aligned region: 602..629
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 224..244
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 605..626
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 702..723
FtsK_SpoIIIE [PF01580], Evalue: 0.0031, Aligned region: 216..266
FtsK_SpoIIIE [PF01580], Evalue: 0.0031, Aligned region: 467..498
FtsK_SpoIIIE [PF01580], Evalue: 0.0031, Aligned region: 594..626
T2SE [PF00437], Evalue: 0.0065, Aligned region: 198..240
T2SE [PF00437], Evalue: 0.0065, Aligned region: 599..681
SRP54 [PF00448], Evalue: 0.0095, Aligned region: 222..243
SRP54 [PF00448], Evalue: 0.0095, Aligned region: 358..388
SRP54 [PF00448], Evalue: 0.0095, Aligned region: 603..636
Protein Sequence: 868 a.a.     [Download]
>gi|317048712|ref|YP_004116360.1| type VI secretion ATPase, ClpV1 family [Pantoea sp. At-9b]
MSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQQQDGDLQQVISHFSLDENALTRD
IVAALDRLPRGASAVSDLAEHIDSAVERAWVYASLKYGASRIRGGHLLIGLLKTYSLASVLKGISAQFAR
INVDALVDQFDALLGQSKEAQQALTQPDVGAAPAAAGSSTLAQYAQDLTARARAGRIDPVTGRDEEIRQM
VDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIAAGDVPAPLRDVQLWLLDIGMLQAGAGMKGEFEARLQ
ALINEVQSSATPIVLFVDEIHTLVGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPALT
RRFQTVQVQEPDEAKAIQMLRSTVSALEKHHQVLLLDEAVSAAVKLSHRYIPARQLPDKAVALLDTACAR
VAVSQGAQPPALEDCLHRLAALDIEAEIAEREAKVGLGAPERQQEIARQHAALSATREALTARWQQERAL
VDQLIALRARCVSEDATALRSELDATRQQLREVQGEEPLLFAAVDASVVAAVVADWTGIPLGRMVKNEID
AVLNLAETLNQRVIGQRHGLDLIAKRVRTSRARLDNPNKPVGVFMLCGPSGVGKTETALALAESLYGGEQ
NIITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHELFFQVFDKG
WMEDGEGRHIDFRNTIIILTSNVGTQLISALCADPELLPQPDALSTALRKPLLEVFPPALLGRLLVVPYY
PLSDAMLAQIVRLQLARIVRRLEENHGIAADIDASVVSQIVQRCTEVESGGRMVDAILTNTLLPQMSQIL
LSAHARDERYRRVLVRCEQGEFVCQFDV
 
Nucleotide Sequence: 2607 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2733647-2731041 Pantoea sp. At-9b chromosome, complete genome
ATGTCAGAAATCAGCCGAGCCGTGTTATTCGGTAAACTGGACACGCTGTTATTTACCTCGCTGGAAAGCG
CCACCGCCTTTTGCAAGCTGCGCGGCAATCCCTATGTCGAGTTGGTGCACTGGTTGCATCAACTGATGCA
GCAACAGGACGGTGACTTACAGCAGGTAATCAGCCATTTTTCACTGGATGAAAACGCGCTGACGCGGGAT
ATCGTGGCGGCACTTGACCGTCTGCCACGCGGTGCGAGTGCCGTCTCCGATCTTGCCGAGCACATCGACA
GCGCCGTAGAGCGCGCCTGGGTCTATGCCTCGCTCAAATACGGAGCCAGCCGCATTCGTGGCGGTCATCT
GCTGATCGGTCTGCTCAAGACCTACAGCCTCGCCAGTGTGCTGAAAGGTATTTCAGCGCAGTTTGCGCGT
ATTAACGTCGATGCCCTGGTGGATCAATTCGATGCTTTACTCGGCCAGAGCAAGGAGGCGCAACAGGCGC
TGACGCAACCTGATGTCGGCGCAGCCCCGGCAGCAGCCGGCAGCAGCACTCTGGCACAGTACGCCCAGGA
TCTTACCGCGCGTGCGCGTGCGGGCCGTATCGATCCGGTGACCGGGCGCGATGAAGAGATCCGTCAGATG
GTGGATATCCTGATGCGCCGTCGTCAGAACAATCCGCTGCTGACCGGCGAAGCCGGTGTCGGCAAGACGG
CGGTGGTGGAAGGGCTGGCACTGCGCATTGCGGCGGGTGATGTGCCTGCGCCCTTGCGCGATGTACAACT
TTGGCTGCTGGATATCGGCATGTTGCAGGCCGGGGCTGGGATGAAAGGGGAGTTTGAAGCGCGCCTGCAA
GCGTTGATCAACGAAGTGCAGTCGAGCGCCACCCCGATTGTGTTGTTTGTGGATGAGATCCACACCCTGG
TCGGCGCGGGCGGACAGCAAGGCACGGGGGATGCCGCTAACCTGCTGAAACCGGCACTGGCACGTGGACA
GTTGCGCACCATCGGTGCCACTACCTGGGCAGAATATAAAAAATATATCGAGAAGGACCCGGCACTGACA
CGTCGCTTCCAGACCGTGCAGGTGCAGGAGCCGGACGAAGCCAAAGCCATCCAGATGCTACGTAGCACGG
TCAGTGCGCTGGAGAAACATCACCAGGTGCTGCTGCTGGATGAAGCGGTCAGTGCAGCGGTCAAACTGTC
GCATCGTTACATCCCGGCGCGGCAGTTACCGGATAAAGCGGTGGCGTTGCTTGATACCGCCTGTGCACGT
GTCGCCGTCAGTCAGGGGGCACAGCCTCCGGCGCTGGAAGATTGTTTGCATCGGCTGGCGGCACTCGACA
TTGAAGCGGAAATTGCCGAGCGCGAGGCGAAAGTGGGGCTGGGTGCCCCCGAGCGCCAGCAGGAAATTGC
CCGGCAGCATGCTGCACTCAGCGCCACGCGCGAGGCATTGACCGCGCGCTGGCAGCAGGAACGTGCGCTG
GTGGATCAACTCATCGCGTTACGTGCACGTTGTGTCAGCGAAGATGCAACGGCGCTGCGCAGTGAGCTGG
ACGCCACCCGACAGCAGTTGCGTGAAGTGCAGGGCGAAGAACCGCTGCTGTTTGCCGCCGTGGATGCCAG
CGTGGTGGCGGCCGTGGTGGCAGACTGGACCGGCATCCCACTGGGGCGCATGGTGAAAAACGAGATCGAT
GCGGTGCTGAACCTGGCGGAAACCCTGAACCAACGGGTCATCGGTCAGCGCCATGGGTTGGATCTGATTG
CGAAACGTGTGCGCACCTCACGCGCCCGTCTGGATAACCCCAACAAACCGGTCGGGGTGTTTATGTTGTG
CGGCCCGTCTGGCGTGGGTAAAACCGAAACCGCGCTGGCGCTGGCCGAATCGCTGTATGGCGGCGAGCAG
AACATCATCACCATCAACATGAGTGAATTCCAGGAAGCGCACACCGTCTCCACCTTGAAAGGCGCGCCTC
CGGGCTATGTCGGTTACGGCGAGGGTGGTGTGCTGACCGAGGCGGTTCGCCGTCGGCCTTATAGTGTGGT
GCTGTTGGATGAAATCGAGAAAGCACACCCGGATGTGCATGAGTTGTTCTTCCAGGTGTTCGACAAAGGC
TGGATGGAGGACGGCGAAGGACGTCATATCGATTTCCGTAACACCATCATCATCCTGACCTCCAATGTGG
GCACACAGCTGATCAGCGCCTTGTGTGCCGATCCGGAACTGTTACCGCAACCTGACGCACTCAGCACGGC
ACTGCGCAAACCGCTGCTGGAGGTGTTCCCGCCCGCGTTGCTTGGACGCCTGCTGGTGGTGCCGTACTAC
CCGCTGAGCGACGCGATGCTGGCACAAATCGTCCGGCTGCAACTGGCACGCATTGTGCGCCGTCTGGAGG
AGAACCACGGTATCGCAGCGGACATTGACGCGAGTGTCGTCAGCCAGATCGTGCAGCGCTGCACCGAAGT
GGAATCCGGCGGACGTATGGTCGATGCCATCCTCACCAATACCCTGTTGCCGCAAATGAGCCAGATACTG
CTCAGCGCCCATGCCCGCGATGAACGTTACCGCCGGGTGCTGGTGCGCTGTGAGCAGGGTGAGTTTGTTT
GCCAGTTTGATGTCTAA