SecReT6
Protein ID: 317048713
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2504
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2733701..2734750 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDE6WEU2
KEGG IDpao:Pat9b_2504
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.40E-106, Aligned region: 26..330
Protein Sequence: 349 a.a.     [Download]
>gi|317048713|ref|YP_004116361.1| type VI secretion protein [Pantoea sp. At-9b]
MSDVAQIIPLSRASRLPDDFWSAVMAAPWRYDLFQLLRRLNAQSGQRYALGRAPLPKFESLRIGQKPSLT
FAPATLASVREREEDGRHDVAIYSFGLFGPNGPLPTHLTEYVRERIDHHQDHSLAAFADLFHHRATLLFY
RAWADAQPTASLDRGDDKRFQDYLACLAGIGFPAQQQASSLSLHARLMLVGHLSRHGHDAEGLVRILRLY
FGVPVRLEQNQAQWLTLDSRDQARLAAGRHMPRLGESAFLGVAVRDVQHRFRLRLGPLTAAQYAHFLPDA
PGACEVRDWVRHYLGIEMQWDLSLILAANEVQGATLGGSARLGYTSWLGQAAQPVDREDFVFEVEAASR
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2734750-2733701 Pantoea sp. At-9b chromosome, complete genome
ATGAGTGATGTCGCACAGATTATCCCATTATCGCGCGCCAGCCGTCTGCCGGACGATTTCTGGTCAGCGG
TGATGGCGGCTCCCTGGCGCTACGACCTGTTCCAGCTGTTACGCCGGTTAAATGCGCAAAGTGGTCAGCG
TTATGCGCTGGGACGTGCGCCACTGCCTAAGTTCGAAAGCCTGCGTATTGGTCAGAAGCCATCCCTGACC
TTCGCCCCCGCGACGCTCGCCTCGGTGCGTGAGCGCGAAGAAGATGGTCGTCATGATGTCGCCATCTACA
GCTTTGGCCTGTTTGGCCCGAACGGCCCGCTACCCACGCACCTGACTGAGTATGTGCGCGAACGTATCGA
CCACCATCAGGATCACAGCCTGGCGGCCTTTGCTGACCTGTTTCACCACCGTGCCACCTTACTGTTTTAC
CGTGCCTGGGCGGACGCGCAGCCGACCGCTTCTCTCGATCGCGGCGACGACAAACGTTTTCAGGACTATC
TGGCCTGTCTGGCCGGGATCGGTTTTCCGGCGCAGCAACAGGCCAGTTCGCTCAGCCTGCACGCGCGCCT
GATGTTGGTGGGGCATCTCAGTCGCCACGGACATGATGCGGAAGGTCTGGTGCGTATTCTGCGCCTCTAT
TTTGGCGTCCCGGTGCGGCTGGAGCAGAACCAGGCGCAGTGGCTGACGCTGGATAGCCGCGATCAGGCGC
GTCTGGCCGCCGGACGGCACATGCCACGCTTGGGGGAATCGGCGTTTCTGGGGGTGGCGGTGCGCGATGT
GCAGCACCGTTTTCGCCTGCGTTTGGGGCCACTCACCGCCGCGCAATATGCCCACTTCTTGCCCGATGCG
CCAGGGGCATGTGAAGTGCGCGACTGGGTGCGGCACTATCTCGGTATTGAAATGCAGTGGGATCTTAGCC
TGATCCTCGCCGCGAACGAGGTCCAGGGCGCGACCCTCGGCGGCAGCGCCCGACTGGGTTACACCAGTTG
GCTGGGACAAGCGGCCCAGCCTGTCGATCGTGAAGATTTTGTTTTTGAAGTTGAGGCTGCCTCGCGCTAG