SecReT6
Protein ID: 317048714
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2505
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2734747..2736621 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDE6WEU3
KEGG IDpao:Pat9b_2505
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.20E-215, Aligned region: 5..624
Protein Sequence: 624 a.a.     [Download]
>gi|317048714|ref|YP_004116362.1| type VI secretion protein [Pantoea sp. At-9b]
MDSKLLDYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEIADPYVERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMIAPGYLAPTPSMAIAQLTPDSRKGDISNGFLVPRGTMMESQSLKKSGVTCSYTTAHDVMLHP
LRISDVTLGGVPGDIPLGELKLSGLGATSALRLRIECEGVSSLSQLTVDELMLYLSGPDIQALRLLELLM
QHRVGIVLQSVEPQPQRQVLADNALQQQGFAPEQALLPDDLRNFDGYRLLQEYFAFPARFQFISLHQLAA
LLRRCEHAKAFDIIILLDKADAELESVVDRSHLALHCTPVINLFPKMAERLKVSDSQHEYHLVVDNIRPL
DYEVHSVQRLFATVQGQREEQVFRPFWSTFSADNGDYGAYFSLRREQRTLSEHAQRYGTRTGYIGSEVFL
SLVDEHHTPWRDDMRYLSAEVMCTSRDLPLMLLQQEQGQFVMPDSIPVSQLTLCKGPTPPRPALAEGLSS
WRLISHLQMNYLSLMDSADGEGAAALRQLLSLYANLAEAPVARQIEGIRHCQLRAVHRRVPEPGPVVFAR
GVSIALEVDEQVFSGASPWLFGSVLERVFSRLVALNSFTELTLSSQQRGEVGYWPPRMGQKALL
 
Nucleotide Sequence: 1875 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2736621-2734747 Pantoea sp. At-9b chromosome, complete genome
ATGGACAGCAAACTGCTCGACTACTACAACCGTGAACTGGCCTATCTGCGAGAGATGGGAGCCGAGTTTG
CCGAACGTTATCCCAAAGTGGCAGGACGGCTGGGAATGCGCGGCATTGAGATCGCCGATCCTTACGTCGA
GCGGTTGATGGAAGGCTTCGCGTTTCTCACCTCGCGTGTTCAGCTGAAAATGGATGCGGAATTTCCGCGT
TTTTCGCAGCGACTGCTGGAGATGATTGCACCGGGCTATTTAGCGCCAACACCGTCGATGGCGATTGCCC
AATTGACACCGGATAGCCGCAAAGGGGACATCAGCAACGGTTTTCTGGTGCCGCGTGGCACCATGATGGA
GAGCCAGAGCCTGAAGAAATCGGGCGTCACCTGTAGCTACACCACGGCGCATGACGTGATGTTGCATCCG
TTACGCATCAGCGATGTGACGCTCGGTGGCGTGCCCGGTGACATCCCGCTGGGTGAGCTGAAGTTGAGCG
GCCTGGGTGCGACCAGCGCGTTGCGCCTGCGGATTGAGTGCGAAGGCGTTTCGTCGCTCAGCCAACTGAC
GGTCGACGAGTTGATGCTCTACCTGAGCGGCCCGGATATTCAGGCGCTCAGGTTGCTGGAGTTGCTGATG
CAGCATCGGGTCGGCATCGTGTTGCAATCGGTGGAGCCACAGCCGCAGCGTCAGGTACTCGCCGATAACG
CGCTGCAACAACAGGGTTTTGCGCCGGAACAGGCGTTGTTACCGGACGATCTGCGCAACTTCGATGGCTA
CCGTCTGTTGCAGGAATATTTTGCCTTTCCGGCACGGTTTCAGTTTATCAGCCTGCATCAACTGGCGGCG
CTGCTGCGCCGTTGCGAACATGCCAAAGCCTTCGACATCATTATCCTGCTGGATAAGGCCGATGCTGAAC
TGGAGAGCGTGGTCGATCGCAGCCATCTGGCGCTGCATTGCACGCCGGTGATTAACCTGTTCCCGAAAAT
GGCAGAGCGCCTGAAAGTCAGCGACAGTCAGCATGAATATCATCTGGTGGTGGATAATATCCGCCCGCTG
GATTACGAAGTGCATTCGGTACAACGTTTGTTTGCCACCGTGCAGGGACAGCGTGAGGAGCAGGTATTCC
GTCCTTTCTGGAGCACTTTCAGCGCGGATAACGGTGACTACGGTGCCTATTTTTCCCTGCGTCGCGAGCA
GCGCACGTTGTCCGAGCATGCGCAACGCTATGGCACCCGTACCGGTTATATCGGCTCTGAAGTGTTCCTC
TCGCTGGTGGATGAACACCACACACCGTGGCGCGACGATATGCGCTACCTCTCCGCTGAGGTGATGTGCA
CCAGCCGCGATTTACCGCTGATGCTGCTGCAACAGGAGCAGGGGCAGTTCGTGATGCCGGATTCGATCCC
GGTGAGTCAACTGACGTTGTGCAAAGGGCCAACGCCGCCGCGTCCGGCACTGGCAGAAGGCTTATCGTCC
TGGCGGCTGATCAGCCATCTGCAAATGAACTATCTGAGCCTGATGGACAGCGCCGACGGGGAAGGGGCGG
CCGCCTTGCGCCAGCTACTGAGTTTGTATGCCAATCTGGCGGAAGCGCCAGTGGCGCGCCAGATCGAGGG
CATTCGTCATTGCCAACTGCGTGCGGTACATCGGCGAGTACCGGAACCGGGACCCGTGGTGTTTGCTCGT
GGGGTCAGCATTGCGCTGGAGGTGGATGAGCAGGTGTTCTCCGGGGCCAGTCCGTGGCTGTTTGGCAGCG
TGCTGGAACGGGTGTTCTCGCGTCTGGTGGCGCTCAACAGTTTCACCGAACTCACGCTGAGCAGCCAGCA
ACGTGGCGAAGTGGGTTACTGGCCACCGCGGATGGGCCAGAAGGCGCTGCTATGA