SecReT6
Protein ID: 317048715
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2506
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2736624..2737184 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDE6WEU4
KEGG IDpao:Pat9b_2506
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.70E-20, Aligned region: 55..165
Protein Sequence: 186 a.a.     [Download]
>gi|317048715|ref|YP_004116363.1| type VI secretion system lysozyme-like protein [Pantoea sp. At-9b]
MSREDGYAQLHGGYRARKNRDTLTSRDKLQSSLLDRLTDDAPDKRSEPGNSVLITHNTLRRHVLRDLQWL
FNTINNEAQQDLSPFGEVQRSVWNFGVAPLAGQNMSDIEWQDIQRKMTNAILHFEPRILPQGLQVRCVSD
LAALDLHNVLSIEIKGRLWCVPYPLEFLFRTQVDLENGHFELQDAG
 
Nucleotide Sequence: 561 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2737184-2736624 Pantoea sp. At-9b chromosome, complete genome
ATGAGTCGTGAAGACGGCTATGCCCAGCTGCACGGTGGCTATCGTGCGCGCAAAAACCGCGACACGCTGA
CTTCACGCGACAAGTTGCAATCCTCGTTGCTGGATCGCCTGACCGACGATGCACCGGACAAACGGAGCGA
GCCGGGCAACAGTGTGTTGATTACCCATAACACGCTACGCCGTCATGTGCTGCGCGATTTGCAGTGGCTG
TTCAACACCATCAATAACGAAGCGCAACAGGATCTCAGCCCTTTTGGTGAGGTGCAGCGCTCGGTATGGA
ATTTTGGTGTTGCGCCGCTGGCCGGACAAAACATGTCTGATATCGAATGGCAGGACATCCAGCGCAAAAT
GACCAACGCCATTTTGCATTTCGAACCCCGCATTCTGCCACAGGGCTTGCAGGTCCGTTGTGTCAGCGAT
CTGGCGGCACTCGACCTGCACAACGTGCTATCGATTGAGATCAAAGGCCGTCTGTGGTGCGTGCCTTATC
CGCTGGAGTTTCTGTTTCGTACCCAGGTCGATCTTGAGAATGGCCATTTCGAACTCCAGGATGCGGGGTA
A