SecReT6
Protein ID: 317048716
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2507
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2737174..2738001 [-]
Productvirulence protein SciE type
NoteTagJ
UniProt IDE6WEU5
KEGG IDpao:Pat9b_2507
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.50E-38, Aligned region: 144..266
Protein Sequence: 275 a.a.     [Download]
>gi|317048716|ref|YP_004116364.1| virulence protein SciE type [Pantoea sp. At-9b]
MESLQQRLADASLAENLARTTAQIQANPADANLRATFVQLLCLAGNWTRAQTQLHSWLALTPQAQPTITL
LQQAIAGELQRAAVLRGEAQPQLPGSAWAWCETLLAALQAEVAGDVARGAALRQQALEQADANPGTLEQQ
DQSVAFPWLMDGDSRFGPVCEAIVNGRYYWVPFAAIREMQFQAPASVTDLVWRHTLIQLVDGSEQVCQIP
VRYPLPAQAEEPWLRASVTEWQPLGNVDSQFIGLGQKVWLSDSAELSLLALQRLTFNDIGPAYES
 
Nucleotide Sequence: 828 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2738001-2737174 Pantoea sp. At-9b chromosome, complete genome
ATGGAGTCGTTACAACAGCGTTTGGCGGATGCATCACTGGCGGAGAATCTGGCCCGTACTACGGCGCAGA
TCCAGGCGAATCCTGCCGATGCCAATCTGCGCGCCACCTTTGTGCAACTGCTGTGCCTGGCCGGTAACTG
GACGCGGGCACAGACACAACTGCATTCCTGGCTGGCGCTAACCCCGCAGGCACAACCCACCATCACTCTG
TTGCAACAGGCGATTGCCGGGGAGTTGCAGCGTGCGGCGGTGTTACGCGGCGAGGCACAACCCCAACTGC
CGGGCAGTGCCTGGGCATGGTGTGAAACCCTGCTGGCGGCGTTGCAGGCCGAGGTGGCGGGCGATGTGGC
ACGTGGCGCGGCGCTACGCCAGCAGGCACTGGAGCAAGCCGACGCCAATCCCGGTACGTTAGAACAACAG
GATCAGTCAGTGGCGTTCCCGTGGTTGATGGATGGCGACAGCCGTTTTGGTCCGGTATGTGAAGCCATCG
TCAATGGCCGTTATTACTGGGTGCCGTTTGCCGCTATCCGGGAAATGCAGTTTCAGGCACCGGCCAGCGT
AACGGATCTGGTGTGGCGTCATACGCTGATCCAACTGGTGGATGGCAGCGAACAAGTGTGCCAGATTCCG
GTGCGCTATCCCTTACCGGCACAAGCGGAAGAACCCTGGTTGCGCGCCAGCGTCACCGAATGGCAGCCGC
TGGGCAACGTAGACAGCCAGTTTATCGGTCTGGGACAGAAAGTCTGGCTGAGCGACAGCGCGGAACTCTC
ACTGCTGGCACTTCAGCGCCTCACTTTTAACGACATCGGGCCCGCTTATGAGTCGTGA