SecReT6
Protein ID: 317048719
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2510
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2739776..2741581 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDE6WEU8
KEGG IDpao:Pat9b_2510
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.40E-07, Aligned region: 27..93
UreE_N [PF02814], Evalue: 0.00028, Aligned region: 32..49
UreE_N [PF02814], Evalue: 0.00028, Aligned region: 78..99
UreE_N [PF02814], Evalue: 0.00028, Aligned region: 205..217
Protein Sequence: 601 a.a.     [Download]
>gi|317048719|ref|YP_004116367.1| FHA domain-containing protein [Pantoea sp. At-9b]
MRFTIITTKPGHQPPQTLFDFLPPGGTIGRGVDNNLVLPDDDRTISRLQAIVHISADGECRLTNRGNVTR
VLLNDIPLERGRQVELQDGDILGIDDYQLLVNDMHAASSASAVAKPAAKAAITADEPPAVVSSNTAAIPS
EIWDSLAKEFSISDDLSQRNKPAPAPAEAHPLTAPAAVERNPEDPLAALISDAPLDIGQQPTNRSLFDEG
DALFAQDSIFDDATPSALVGQKSAAASVPVENKPDELDPLSLFGSQNTPDPRHHDDPLGLMMSGAVPLAQ
PEIPPLATAQPEAEPEPESKPESEPAAVTPAAVNLAELSSSPLFDDTDTAPAPIVAEEAEEPSAASPTPL
EYGGITLPTPQAVQRTPSPTPKGRLRIDPVASHSQREAAAQSSGDALKGELLDALLEGMGLQDLQPTPQF
DRDQMRQFGQMLSMFSQGTVALLSSRSILKRGVKADMTVILDDANNPFKLLPSGKTVLMQMFGSRMPGFM
PPRQAVRDALIDLQAHQLGMIAGIRAIIASMLQSFNPDQLEEEAREAGSVSRLGLPGSRKAALWEHFVER
YGETAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQTHTDDA
 
Nucleotide Sequence: 1806 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2741581-2739776 Pantoea sp. At-9b chromosome, complete genome
ATGCGCTTTACGATAATAACGACTAAACCCGGCCATCAGCCGCCGCAAACTCTTTTTGACTTCTTACCCC
CCGGTGGCACCATTGGTCGTGGTGTGGATAACAATCTGGTATTACCCGATGACGATCGTACTATTTCCCG
ATTACAGGCAATTGTGCATATTTCTGCTGACGGTGAATGCCGTCTGACGAATCGTGGCAACGTCACTCGC
GTGCTTTTGAACGATATTCCATTGGAACGTGGACGTCAGGTGGAATTACAGGACGGCGATATTCTTGGCA
TTGATGATTATCAGTTGCTGGTCAACGATATGCACGCCGCATCGTCAGCCAGTGCGGTCGCTAAGCCAGC
AGCCAAAGCGGCAATCACCGCCGATGAGCCGCCCGCAGTGGTCAGCAGCAACACCGCCGCTATCCCCAGT
GAGATCTGGGACAGCCTGGCGAAAGAATTCTCCATCTCTGACGATTTATCGCAACGCAATAAACCTGCGC
CAGCGCCAGCCGAAGCCCATCCGTTGACGGCTCCCGCTGCCGTCGAACGCAACCCGGAAGATCCGCTGGC
TGCGCTGATCAGTGATGCGCCGCTGGATATCGGCCAGCAGCCGACTAATCGCAGTCTGTTTGATGAAGGT
GATGCGTTGTTTGCCCAGGATAGCATTTTTGATGATGCGACCCCGAGCGCGCTGGTGGGACAGAAGAGTG
CTGCGGCCTCTGTACCGGTTGAGAACAAGCCCGATGAGCTGGACCCTCTCAGTCTGTTTGGCAGCCAGAA
CACCCCCGATCCACGTCATCACGATGATCCGTTGGGTTTGATGATGAGCGGGGCGGTACCGCTGGCACAA
CCCGAGATCCCCCCGCTGGCAACGGCGCAGCCAGAAGCGGAACCCGAGCCTGAGTCGAAGCCGGAGTCAG
AGCCAGCGGCAGTCACTCCTGCCGCCGTTAATCTGGCGGAACTCAGCAGCTCACCACTATTTGACGATAC
CGACACTGCGCCAGCGCCGATCGTTGCTGAGGAAGCTGAAGAGCCGAGCGCAGCCAGCCCGACACCGCTG
GAATATGGTGGCATCACCTTGCCGACGCCGCAGGCGGTTCAGCGCACTCCATCACCGACACCGAAAGGGC
GTCTGCGCATTGATCCGGTGGCGTCTCACAGCCAGCGCGAGGCGGCGGCTCAGAGCAGTGGTGATGCGTT
GAAAGGCGAGTTATTGGATGCCTTGCTGGAAGGGATGGGCCTCCAGGATTTGCAGCCCACGCCCCAGTTC
GATCGCGATCAGATGCGCCAGTTCGGCCAGATGCTCAGCATGTTCTCGCAGGGTACCGTCGCTTTGCTCT
CGTCACGTTCCATTCTCAAGCGTGGCGTAAAAGCGGATATGACGGTCATCCTCGACGATGCCAACAACCC
GTTCAAACTGCTGCCTTCCGGCAAAACCGTGCTGATGCAGATGTTTGGCAGCCGGATGCCCGGTTTTATG
CCACCACGCCAGGCGGTACGTGATGCGTTGATCGATCTCCAGGCGCACCAGTTAGGGATGATCGCCGGTA
TCCGCGCCATCATCGCGTCGATGCTGCAATCCTTTAACCCGGACCAGCTGGAAGAAGAAGCGCGCGAGGC
CGGTTCCGTGTCTCGCCTTGGCCTGCCGGGGAGTCGTAAGGCGGCGTTGTGGGAGCATTTTGTCGAGCGC
TACGGCGAAACCGCTGGCGAGATCGAAGACGACTTTCACACCCTGTTCGGCGAAGCTTTCCTGCACGCCT
ACGACATGGAAGTTAATCAGTACAAAGATTCACAAACCCACACGGATGACGCATGA