SecReT6
Protein ID: 317048725
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2516
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2744761..2745243 [-]
Producttype VI secretion system effector
NoteTssD
UniProt IDE6WEV4
KEGG IDpao:Pat9b_2516
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-37, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|317048725|ref|YP_004116373.1| type VI secretion system effector [Pantoea sp. At-9b]
MAIDMFLKVDGVTGESKDSNHTGWTDITSFNWGATQPGNMAVGGGGGAGKVNFNDLNVNALIDKSTSAIL
KYCANGKHVTKVELSICKAGGSQVEYARITLEDVLVSRVDYTGADNGDTLSMAYSFQAAKVKQQYWEQSS
SGGKGAESSAGWNIKENKEA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2745243-2744761 Pantoea sp. At-9b chromosome, complete genome
ATGGCTATTGATATGTTTTTAAAAGTTGATGGTGTGACGGGTGAATCTAAAGATTCTAACCACACCGGTT
GGACCGATATTACCTCCTTTAACTGGGGCGCAACTCAACCGGGAAATATGGCGGTTGGCGGTGGCGGCGG
TGCGGGTAAAGTTAATTTTAATGATCTGAATGTCAATGCGTTGATCGATAAATCCACATCCGCCATTCTG
AAATATTGCGCTAATGGTAAGCACGTTACCAAAGTTGAGTTGTCCATTTGCAAAGCGGGTGGTTCTCAGG
TTGAGTATGCGCGTATCACCCTTGAAGATGTACTGGTTTCCCGCGTAGATTATACCGGTGCTGATAATGG
CGATACACTGAGCATGGCTTACTCATTCCAGGCCGCGAAAGTGAAACAGCAATACTGGGAGCAGAGCTCT
TCCGGTGGTAAAGGTGCAGAAAGCAGCGCAGGCTGGAATATCAAGGAAAATAAAGAGGCGTAA