SecReT6
Protein ID: 317048726
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2517
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2745462..2746958 [-]
Producttype VI secretion protein
NoteTssC
UniProt IDE6WEV5
KEGG IDpao:Pat9b_2517
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.90E-197, Aligned region: 65..491
Protein Sequence: 498 a.a.     [Download]
>gi|317048726|ref|YP_004116374.1| type VI secretion protein [Pantoea sp. At-9b]
MSEKLQQQPQGASSFSQDEFSALLSKEFRPKNDQAREAVENAVKTLAQQALENSVTISNDSYRTIQSLIA
EIDEKLSQQVNQIIHHQEFQKLESAWRGLSYLVNNTETDEMLKIRFMSISKQELGRTLKRYKGVGWDRSP
LFKKIYEQEYGQFGGEPFGCLVGDYYFDHGPQDVELLGEMARIGAAAHCPFITGAAPEVMQMESWQELAN
PRDLTKIFQNTEYAAWRSLRESEDSRYLGLVMPRFLARLPYGIRTNPVDSYDFEEQTDGSDHNNYAWSNA
AYAMAANINRSFKEYGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFMP
LVHRKNSDFAAFIGAQSLQKPAEYHDADATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEME
RWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVNVEEQEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSKL
PSLKTNDK
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2746958-2745462 Pantoea sp. At-9b chromosome, complete genome
ATGAGCGAGAAATTGCAGCAGCAGCCGCAAGGCGCATCCAGCTTCAGCCAGGATGAATTCAGCGCTCTTC
TCAGCAAAGAGTTTCGTCCGAAGAACGATCAGGCACGGGAAGCGGTTGAAAACGCGGTCAAAACCCTGGC
ACAGCAAGCGCTGGAGAACAGCGTCACCATCTCCAACGATTCGTACCGCACTATCCAGTCACTGATCGCG
GAAATTGACGAGAAATTGTCGCAGCAGGTTAACCAGATTATTCACCACCAGGAGTTCCAAAAACTGGAAA
GTGCGTGGCGTGGCCTGAGTTATCTGGTGAACAACACCGAAACCGATGAGATGCTGAAAATCCGCTTTAT
GAGTATCTCCAAGCAGGAACTGGGACGGACCCTGAAGCGTTACAAAGGCGTTGGCTGGGATCGCAGCCCG
CTGTTTAAGAAAATCTATGAGCAGGAATATGGCCAGTTTGGCGGTGAACCTTTCGGTTGCCTGGTCGGGG
ATTACTACTTTGACCATGGTCCACAGGATGTGGAACTGCTGGGTGAGATGGCACGTATTGGCGCAGCGGC
CCACTGTCCGTTTATCACCGGTGCGGCACCGGAAGTGATGCAGATGGAATCATGGCAGGAACTGGCGAAC
CCACGCGATCTGACCAAGATTTTCCAGAACACCGAATATGCCGCCTGGCGCAGCCTGCGTGAGTCGGAGG
ATTCACGTTACCTTGGCCTGGTGATGCCACGTTTCCTTGCGCGCCTGCCATACGGTATCCGTACCAATCC
GGTGGACAGTTATGATTTTGAGGAGCAAACCGATGGCTCTGATCATAACAATTACGCCTGGAGCAACGCC
GCCTATGCGATGGCTGCCAACATCAACCGTTCATTTAAAGAGTATGGCTGGTGTACCTCGATCCGTGGTG
TGGAGTCGGGCGGGGCGGTCGAAAACCTGCCGTGCCATACCTTCCCCAGTGACGATGGTGGTGTGGACAT
GAAATGTCCGACCGAGATCGCCATCAGTGACCGTCGTGAAGCTGAGCTGGCAAAAAACGGTTTTATGCCG
CTGGTGCATCGTAAGAATTCGGACTTCGCGGCCTTTATTGGTGCGCAGTCACTGCAGAAACCGGCGGAAT
ACCACGATGCTGATGCTACTGCCAATGCGCGTCTGGCGGCACGTCTGCCGTATCTGTTTGCCTGCTGCCG
CTTTGCTCACTATCTGAAGTGCATCGTGCGTGACAAAATCGGCTCCTTCCGTGAGCGCGATGAGATGGAG
CGCTGGCTGAACGACTGGGTGATGAACTACGTAGACGGCGACCCGGCTAACTCTTCGCAGGAAACCAAAT
CACGCAAACCGTTGGCCGCAGCCGAGGTTAACGTTGAGGAGCAGGAAGACAATCCGGGTTATTACGCGGC
GAAATTCTTCCTGCGTCCGCATTATCAGCTGGAAGGCCTGACGGTATCGCTGCGTCTGGTGTCGAAACTG
CCTTCGCTGAAGACCAATGATAAGTAA