SecReT6
Protein ID: 317048727
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2518
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2746958..2747488 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDE6WEV6
KEGG IDpao:Pat9b_2518
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.20E-61, Aligned region: 12..162
Protein Sequence: 176 a.a.     [Download]
>gi|317048727|ref|YP_004116375.1| type VI secretion protein [Pantoea sp. At-9b]
MATMKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLAGKPLEPQAAVDDRKFLEIDIDN
FDERMKAMKPRAAFQVDNTLTGEGKLNVELTFESMDDFSPDAIARHVEPLNKLLEARTQLANLLTYMDGK
NGAEELIGKILHDPTLLQALTHLPKQADVAEGKEEQ
 
Nucleotide Sequence: 531 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2747488-2746958 Pantoea sp. At-9b chromosome, complete genome
ATGGCCACAATGAAATCCAGCGGGCAGAAATTTATCGCCCGCAATCGCGCGCCCCGCGTTCAAATCGAAT
ATGACGTGGAGATCTATGGCGCGGAACGCAAAATCCAGCTGCCGTTCGTGATGGGTGTGCTGGCAGACCT
CGCTGGCAAGCCACTGGAACCGCAGGCTGCCGTCGATGACCGTAAATTCCTTGAGATCGATATTGATAAC
TTTGACGAGCGCATGAAGGCGATGAAACCGCGTGCGGCGTTTCAGGTTGATAACACCCTGACGGGTGAGG
GCAAACTCAATGTCGAACTGACCTTCGAAAGCATGGATGACTTCTCGCCCGATGCGATTGCCCGCCACGT
GGAGCCACTGAACAAGCTGCTGGAAGCACGTACCCAGCTTGCCAACCTGTTGACTTATATGGATGGCAAA
AACGGTGCGGAAGAGTTGATTGGCAAAATTCTGCATGACCCGACGCTGTTGCAGGCGCTGACGCATCTGC
CGAAGCAGGCCGACGTGGCAGAAGGTAAGGAGGAACAATAA