SecReT6
Protein ID: 317048728
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2519
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2747561..2748571 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDE6WEV7
KEGG IDpao:Pat9b_2519
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.60E-22, Aligned region: 54..113
Protein Sequence: 336 a.a.     [Download]
>gi|317048728|ref|YP_004116376.1| type VI secretion-associated protein [Pantoea sp. At-9b]
MTINLDALLEPISNDDPCGDNLEYHADFQAMEQASAGKAEQQFGETIIPAEPADWNRVEKLATELLSRSK
DLRVMLSLTQAWTHLNGLPGYAQGLELIEQALLRYWEPLWPRLEEDGEQDPFYRINALALLEDASTLTAA
VRQAWLLRHASDAITLRDAIALCDGSKMETPDYPGGMARLRDELAQQGQPAAATLQHIHQHLQSLHALLA
ERLGESAVPDMAQLQKSFALLVSLTQSADTAEAQPDVTDDQHADAPASMATRHAPDWRTAQLTSRADAQL
MLEKVKQYFAQHEPSHPAPLMIDRVQRLIELDFMDIIRDLAPDGVHQLQNIFGRHD
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2748571-2747561 Pantoea sp. At-9b chromosome, complete genome
ATGACAATCAATCTCGATGCGTTGCTGGAGCCGATCAGCAACGACGACCCCTGCGGCGACAACCTGGAAT
ATCACGCCGATTTCCAGGCGATGGAACAAGCCAGCGCCGGTAAAGCTGAGCAACAATTTGGTGAAACCAT
TATCCCGGCAGAGCCGGCTGACTGGAACCGGGTGGAAAAGCTGGCAACGGAGTTGCTGAGCCGCAGTAAA
GATTTGCGCGTAATGCTGTCCCTCACCCAGGCGTGGACCCATCTTAACGGTCTGCCAGGCTATGCGCAGG
GGCTGGAACTGATTGAGCAGGCGCTATTGCGCTACTGGGAACCCCTCTGGCCCCGGCTGGAAGAGGACGG
CGAACAGGACCCGTTCTATCGCATCAACGCGTTGGCACTGCTTGAGGACGCGTCTACGTTAACGGCAGCG
GTGCGGCAGGCCTGGCTGTTACGTCACGCCTCGGACGCCATCACGCTACGTGATGCCATCGCCCTGTGTG
ATGGCAGCAAAATGGAGACACCTGACTACCCGGGTGGGATGGCGCGTTTGCGCGACGAACTGGCGCAGCA
GGGGCAACCTGCCGCCGCCACCTTGCAGCACATTCATCAACACCTGCAAAGCCTGCATGCGCTCCTCGCT
GAACGTCTTGGTGAAAGCGCGGTGCCTGATATGGCGCAATTGCAGAAAAGTTTTGCGTTGCTGGTCAGCC
TGACGCAATCCGCTGATACCGCGGAAGCACAACCTGATGTCACCGATGATCAGCACGCCGACGCGCCAGC
GTCGATGGCGACCCGCCATGCACCGGACTGGCGCACAGCACAGTTAACCAGCCGCGCGGATGCCCAATTG
ATGCTGGAAAAGGTGAAGCAATACTTCGCCCAGCATGAGCCAAGCCATCCGGCTCCGTTAATGATTGACC
GCGTACAGCGGCTGATCGAACTCGATTTTATGGACATCATCCGCGATCTGGCACCGGATGGCGTTCATCA
GTTGCAAAACATCTTCGGACGCCACGACTAA