SecReT6
Protein ID: 317048731
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2522
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2752942..2754180 [-]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDE6WEW0
KEGG IDpao:Pat9b_2522
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.70E-69, Aligned region: 20..225
DUF2077 [PF09850], Evalue: 5.70E-69, Aligned region: 353..389
OmpA [PF00691], Evalue: 1.90E-15, Aligned region: 290..388
Protein Sequence: 412 a.a.     [Download]
>gi|317048731|ref|YP_004116379.1| DotU family type IV/VI secretion system protein [Pantoea sp. At-9b]
MQPQQKPNSDAAQPDVSHQNVLVAAANPLINAIPQIRHSVSHDDPARLRQQLIDQIRHFELSCQQSGLSY
EVIIGARYCLCTALDEAAALTPWGSRGVWTSNGLLVTFHNETWGGEKFFQLLAKLSQNPRQHILLLELIY
FCLLLGFEGRYRVLDNGRSQLETIKQRLLQMIKSVRGSYAAALSVHPTDQPVLRKLWRPMIPLWAFAAVA
ALGACLFYIILNWRLGDYTTPVLANIYQTSLPEMQIRNPAPPPPAALNLKTFLKPEIDAGLVAVRDEADQ
SVVTLKGDGLFTSGATTVRGRYEAVIQRIAAAMNNVSGKILVVGYSDNVPIRSARFASNYELSLARAQSV
QTLLQQQLTQPARVKAEGRGESNPLVPNTSAENRARNRRVEITLLVAPDATQAELNGLARGN
 
Nucleotide Sequence: 1239 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2754180-2752942 Pantoea sp. At-9b chromosome, complete genome
ATGCAGCCACAACAGAAACCGAATAGCGATGCCGCACAGCCCGATGTTAGCCACCAGAATGTGTTGGTGG
CGGCGGCCAACCCGCTGATTAACGCCATCCCGCAGATCCGGCACTCCGTTTCCCATGACGATCCCGCGCG
TCTGCGTCAGCAATTGATTGATCAGATCCGTCACTTTGAACTGAGTTGTCAGCAGTCGGGCCTGAGTTAT
GAAGTGATCATTGGTGCGCGTTACTGCCTGTGCACCGCGCTGGATGAAGCCGCCGCACTGACGCCCTGGG
GCAGTCGTGGCGTCTGGACCAGCAACGGTTTGCTGGTCACTTTTCACAATGAAACCTGGGGCGGGGAGAA
GTTTTTCCAGTTGCTGGCCAAACTGTCGCAGAATCCGCGTCAGCATATCCTGTTGCTGGAATTGATCTAC
TTTTGCCTGCTGCTCGGTTTTGAAGGGCGCTATCGGGTGCTGGACAACGGGCGCTCGCAGCTGGAAACCA
TCAAACAACGACTGTTGCAGATGATCAAAAGCGTGCGCGGCAGCTATGCGGCGGCACTGTCGGTGCATCC
GACCGATCAACCGGTGTTGCGCAAGTTGTGGCGTCCGATGATCCCGCTGTGGGCCTTTGCTGCGGTGGCG
GCGCTCGGTGCCTGTCTGTTCTATATCATTCTTAACTGGCGGCTGGGTGATTACACCACGCCGGTACTGG
CCAACATCTATCAAACCTCATTACCGGAAATGCAGATCCGTAATCCGGCACCGCCGCCGCCTGCTGCGCT
TAATCTGAAAACTTTCCTCAAGCCGGAAATTGATGCCGGTCTGGTGGCGGTGCGTGATGAGGCCGATCAA
AGCGTCGTGACGCTGAAAGGGGATGGCTTGTTCACCTCCGGCGCGACCACAGTGCGTGGCCGTTATGAAG
CGGTTATCCAACGTATTGCGGCGGCGATGAATAACGTCAGCGGCAAGATTCTGGTGGTGGGTTACAGCGA
TAACGTTCCGATCCGCAGCGCCCGTTTTGCTTCCAACTATGAACTCTCCCTGGCACGCGCTCAGTCGGTT
CAAACCTTGTTGCAACAGCAACTCACCCAACCGGCACGCGTGAAAGCAGAAGGGCGCGGCGAGAGCAATC
CGCTGGTGCCAAATACCAGTGCCGAGAACCGTGCGCGTAACCGCCGTGTGGAGATCACGCTGCTGGTGGC
ACCGGATGCGACGCAAGCTGAACTTAACGGCCTGGCGAGAGGGAACTAA