SecReT6
Protein ID: 317048732
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2523
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2754200..2755540 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDE6WEW1
KEGG IDpao:Pat9b_2523
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.10E-146, Aligned region: 19..442
Protein Sequence: 446 a.a.     [Download]
>gi|317048732|ref|YP_004116380.1| type VI secretion protein [Pantoea sp. At-9b]
MNRAEKVVWTEGMFLRPHHFQQSENFLHSTLREWGQSQRVYTWGFFDVEFDEALLRQGKLALNAASGCLP
DGTFFAFSQPQQGPAPLDLPDNVDRAKVVLAIPTRRNGREAVTFQDSQDSLARYLAWESEVEDDNALAVG
AATVQFGKLRLRLMLEQDLTAEWTAMGVARVVEKRSDNHLRLDSDYIPPMLTLTGSHGLQSMMNDLHGLI
QQRSQQLSQRTPGTGRFNSADMVDFMLLALLNRQLGLHAHLQSLPLLHPESLFSHWLQLASELCTWSPAR
TPDVFPRYDHDDLHGCFTRLTLQLRQALSQVMEESAIQLPLTQRSHGLNVATVPESSMVREFGFVLAVKA
SVPAEALKTHFPAQMKVAPVTKIRDLVQLQLPGLSLIAMPGAPPQIPWHAGYSYFELDKNSELWKEMERS
GAFALHLAGEFPGLNMEFWAIRSQSE
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2755540-2754200 Pantoea sp. At-9b chromosome, complete genome
ATGAACAGAGCCGAAAAGGTGGTGTGGACGGAAGGTATGTTTCTGCGCCCACATCACTTCCAGCAGTCGG
AAAATTTTCTACACAGTACCTTACGTGAATGGGGTCAGTCCCAGCGCGTCTACACCTGGGGATTTTTTGA
CGTTGAGTTTGACGAGGCGTTGTTGCGTCAGGGCAAGCTGGCCTTAAATGCGGCCAGCGGCTGCCTGCCA
GATGGCACTTTTTTTGCCTTCAGCCAGCCTCAGCAGGGACCGGCTCCGTTGGATCTGCCAGACAATGTCG
ATCGGGCCAAAGTGGTGCTGGCAATCCCGACGCGGCGCAATGGCCGCGAGGCCGTGACCTTTCAGGATTC
GCAGGACTCGCTGGCACGTTATCTGGCTTGGGAAAGTGAGGTGGAGGATGACAACGCACTGGCGGTCGGT
GCGGCCACGGTTCAATTCGGTAAATTGCGCCTGCGCCTGATGCTGGAGCAGGATCTCACCGCAGAATGGA
CGGCGATGGGGGTGGCGCGCGTGGTGGAAAAGCGCAGCGATAATCACCTGCGTCTCGACAGCGATTACAT
CCCGCCGATGCTTACCCTGACCGGGAGTCACGGGCTGCAAAGTATGATGAACGACCTGCATGGCCTGATC
CAGCAACGCAGTCAGCAACTGAGTCAGCGCACGCCGGGCACCGGCCGTTTTAACAGCGCCGATATGGTCG
ACTTCATGCTGCTGGCCTTGTTAAACCGGCAGTTGGGTCTGCATGCACATCTGCAAAGCTTACCGTTACT
GCATCCTGAATCCCTGTTTAGCCACTGGCTGCAACTGGCGTCAGAGCTGTGCACCTGGTCACCCGCCCGC
ACGCCAGATGTCTTCCCGCGTTATGACCATGACGATCTGCATGGCTGCTTTACGCGATTGACCTTACAAC
TGCGCCAGGCCTTGTCGCAGGTGATGGAGGAGAGCGCCATTCAACTGCCACTGACCCAGCGTTCGCATGG
GTTGAATGTGGCAACGGTGCCGGAAAGCAGCATGGTGCGCGAGTTTGGCTTCGTGCTGGCGGTAAAAGCC
AGCGTACCTGCCGAGGCGTTAAAAACCCATTTCCCGGCGCAGATGAAAGTCGCGCCTGTCACCAAAATTC
GCGATCTGGTGCAACTTCAGTTGCCAGGCCTGTCGCTGATCGCCATGCCGGGTGCGCCACCGCAAATCCC
GTGGCATGCCGGCTACAGCTACTTTGAACTGGATAAAAACAGTGAGCTGTGGAAGGAGATGGAGCGATCA
GGCGCCTTTGCGCTTCATCTCGCCGGAGAATTTCCAGGCCTGAATATGGAGTTCTGGGCCATTCGCAGTC
AGTCAGAATAA