SecReT6
Protein ID: 317048733
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2524
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2755550..2756041 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDE6WEW2
KEGG IDpao:Pat9b_2524
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.10E-26, Aligned region: 15..132
Protein Sequence: 163 a.a.     [Download]
>gi|317048733|ref|YP_004116381.1| type VI secretion lipoprotein [Pantoea sp. At-9b]
MLLSRLRKWCLPLFALLLAACSSGQTSVARYNLHFQAHPQINAGAPLKVRVMLLTSDAAFMSADFYSLQN
QPATVLGSSLLNNQELFLRAGQLSNTLSGKSLAEARFIGIMAEYQTLDGKVWRLALPFPDGDDSAFWQFW
KSNDGELDANIVADINGLRLVKQ
 
Nucleotide Sequence: 492 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2756041-2755550 Pantoea sp. At-9b chromosome, complete genome
ATGTTGCTAAGTCGCCTGAGAAAGTGGTGTTTGCCGCTGTTCGCCTTGCTACTGGCCGCATGCAGTAGCG
GGCAGACCTCAGTGGCGCGTTACAACCTGCATTTCCAGGCGCATCCGCAGATCAATGCGGGTGCGCCGCT
CAAAGTTCGAGTGATGTTATTAACCTCTGACGCCGCATTTATGTCTGCGGATTTCTATTCGCTGCAAAAC
CAGCCAGCCACGGTGCTGGGCAGTTCACTGTTGAACAATCAAGAGCTCTTCCTGCGGGCAGGGCAGCTTA
GCAACACGCTCAGTGGCAAGAGCCTGGCGGAAGCGCGCTTCATCGGCATCATGGCCGAATATCAGACGTT
GGATGGCAAAGTCTGGCGTCTGGCGCTGCCCTTCCCGGATGGGGATGACAGTGCGTTCTGGCAGTTCTGG
AAAAGTAATGATGGCGAGCTGGATGCCAACATCGTTGCCGATATCAACGGCCTGCGCCTGGTTAAGCAGT
AA