SecReT6
Protein ID: 319778078
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6358
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]296709..297818 [+]
Productompa/motb domain protein
NoteTagL
UniProt IDE8TPU9, E8TPU9, E8TPU9
KEGG IDmci:Mesci_6358
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.70E-20, Aligned region: 44..64
OmpA [PF00691], Evalue: 1.70E-20, Aligned region: 133..152
OmpA [PF00691], Evalue: 1.70E-20, Aligned region: 263..358
YceI [PF04264], Evalue: 3.30E-16, Aligned region: 44..212
Protein Sequence: 369 a.a.     [Download]
>gi|319778078|ref|YP_004134508.1| ompa/motb domain protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
MFEVVGVWWKTRARGWLVINALGLVVALLVLIWPGLGTAKAETNWTLDSTASVLTYQSVKKNTIVETNKI
RNISGSLTSAGDAKVTFDLNSVDTGVDLRNVRMRFLFFETFKFPSAELTAKVDPAAFADLATKRRVKAVL
PFRLSLHGVDKDLQANIVVTMISDTMVSVASEAPVAVHVEDFGLLPNVDKLQQAANVTNIVPTASVSFDF
VFIADGSKPAVVQPVAASTADVGPVTTDAAKTSFSDEECLNRFAVLSRTGAIYFRTASARLDSQSRPLLA
EVVGVVGKCPGLKVEVSGHTDSDGSPIENKRLSERRAQAVADAIVAAGIPRTQIAATGYGEERPVADNDT
PKNKALNRRIEFSATKLVN
 
Nucleotide Sequence: 1110 bp     [Download]
>gi|319777789|ref|NC_014918.1|:296709-297818 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGTTCGAAGTCGTGGGAGTCTGGTGGAAAACACGGGCAAGAGGCTGGCTCGTTATAAACGCGCTTGGCT
TGGTCGTTGCGTTGTTGGTGTTGATTTGGCCCGGACTGGGAACTGCGAAGGCAGAGACGAACTGGACGCT
GGACTCGACCGCTTCGGTCCTGACCTACCAGTCGGTCAAGAAGAACACGATCGTCGAAACCAACAAGATC
AGGAATATTTCCGGTAGCCTCACCTCGGCGGGTGATGCGAAAGTCACCTTCGACCTCAATTCGGTCGATA
CAGGGGTTGACCTTCGCAACGTCCGCATGCGGTTCCTTTTCTTCGAGACATTCAAGTTTCCCTCCGCCGA
ACTGACCGCGAAGGTAGATCCCGCCGCATTTGCCGACCTGGCGACCAAGCGACGTGTGAAGGCGGTTCTT
CCGTTCCGTCTCAGCCTGCACGGGGTCGACAAGGATCTTCAAGCCAACATCGTGGTCACCATGATCAGCG
ACACCATGGTGTCGGTCGCTTCGGAGGCTCCTGTCGCCGTGCATGTGGAAGACTTCGGATTGCTGCCGAA
CGTGGATAAACTCCAGCAGGCGGCCAACGTGACCAATATTGTTCCCACGGCATCGGTTTCATTCGATTTC
GTTTTCATCGCTGACGGCAGCAAGCCGGCTGTTGTCCAACCGGTTGCGGCGAGCACTGCCGATGTCGGGC
CTGTCACCACCGATGCGGCGAAGACCAGCTTCAGCGACGAGGAGTGCCTCAACAGGTTCGCGGTGCTGTC
GCGCACCGGAGCCATCTACTTTAGAACGGCGAGCGCGCGGCTCGATAGCCAAAGCCGGCCGCTGCTTGCT
GAGGTCGTCGGCGTCGTGGGCAAGTGCCCGGGCCTGAAGGTCGAGGTTTCTGGACACACCGATTCCGACG
GGTCGCCCATCGAGAACAAGCGCCTGTCGGAGCGAAGGGCCCAGGCGGTTGCCGACGCCATAGTTGCCGC
TGGCATTCCGCGCACCCAGATCGCGGCGACTGGCTATGGCGAGGAGCGCCCGGTTGCCGACAACGACACG
CCGAAGAACAAGGCGCTCAATCGGCGGATCGAGTTTTCCGCCACTAAGCTCGTCAACTGA