SecReT6
Protein ID: 319778081
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6361
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]299886..300416 [+]
Productompa/motb domain protein
NoteTagL
UniProt IDE8TPV2
KEGG IDmci:Mesci_6361
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.20E-20, Aligned region: 73..161
Protein Sequence: 176 a.a.     [Download]
>gi|319778081|ref|YP_004134511.1| ompa/motb domain protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
MQWSSSAFVLAVVLFSTHASADPVQKSEDIVKFFAGAADLGKSRGICVGSAEECKSKSNDASAVKTGLDM
LINFGLDSAELDATARAELDEFAKALKDNRLSTFSFVVEGYTDATGTVHHNEGLSQRRAKSVAAFLTASG
IEPDRINAVGMGEKNPRSSNPYDPLNRRVEMRIKTQ
 
Nucleotide Sequence: 531 bp     [Download]
>gi|319777789|ref|NC_014918.1|:299886-300416 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGCAGTGGAGCAGTTCAGCTTTTGTGTTGGCGGTCGTGCTTTTCTCGACCCACGCTTCCGCCGACCCCG
TTCAGAAATCGGAAGACATCGTGAAGTTTTTTGCTGGTGCGGCCGATCTCGGCAAGTCCCGCGGGATTTG
TGTTGGCTCCGCGGAGGAGTGCAAAAGCAAGTCCAATGACGCGTCGGCAGTGAAAACCGGCCTCGACATG
CTGATCAATTTCGGCTTGGATTCGGCCGAACTTGACGCCACCGCGCGCGCTGAACTCGACGAGTTCGCCA
AAGCCCTGAAGGACAACCGGCTGAGCACGTTCAGCTTCGTCGTCGAAGGCTATACCGATGCCACCGGCAC
GGTGCACCACAACGAAGGCCTGTCGCAACGACGAGCGAAATCGGTAGCCGCCTTCCTCACGGCCAGCGGC
ATCGAGCCTGATCGCATCAACGCGGTCGGCATGGGTGAAAAGAACCCGCGCAGTTCCAACCCATACGATC
CGCTCAATCGCCGCGTGGAAATGCGGATAAAGACACAATAG