SecReT6
Protein ID: 319778087
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6367
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]310276..311772 [-]
Producttype IV / vi secretion system protein, dotu family
NoteTssL
UniProt IDE8TPV8, E8TPV8
KEGG IDmci:Mesci_6367
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-53, Aligned region: 103..306
OmpA [PF00691], Evalue: 2.00E-15, Aligned region: 387..486
Protein Sequence: 498 a.a.     [Download]
>gi|319778087|ref|YP_004134517.1| type IV / vi secretion system protein, dotu family [Mesorhizobium ciceri biovar biserrulae WSM1271]
MSSKDDPFGPAGKTVIRANPRRTQKPPPVPEQSIADTSRIEDSTVFDPGVVRPPGWVSGTVIYQGPALGA
PAGTSSSAAASKPPIEQRMLLGAAEVVRYCAANTILAAAAPLLMLFGQLRLMPVERQAEPLAQHVAEAIE
KFDRTVEKSDVAEEDARIARYVLCETADDLIGNLPWPGKDDWSQRSMSWQFFHTQSSGTGFYEALNKILA
HPETHYDLLELMHVCLSLGFEGQYRGVRREDNNLERVRRDVYETLRYFRTRAGEDISPRWQGLAETMAQS
SARLPLWVVAASASALLAAAFFALRVFISNEGDAAAGELLALNPSIPVAIERASVAPLVEPAKVAPPAAN
AQIDRIRAALAKDVEGGGLAIGTKGDFIVVEINNLLLFQSGRAETKPEFQPIAADIAAALEHEPGPIRIV
GHTDNVKPRRSSAFKSNFDLSLARAKAVEALMAAKFSDPSRLTVDGKGEDEPIAENATPEGRARNRRVDV
MIPREETL
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|319777789|ref|NC_014918.1|:c311772-310276 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGAGCTCGAAGGACGACCCCTTCGGTCCGGCGGGCAAGACCGTCATTCGCGCAAATCCACGGCGCACGC
AAAAACCGCCGCCGGTTCCGGAGCAATCCATCGCGGACACCTCCAGGATCGAGGATTCAACCGTGTTCGA
TCCTGGCGTCGTGCGGCCACCGGGCTGGGTATCAGGAACCGTCATCTATCAAGGCCCGGCCCTGGGTGCC
CCAGCAGGTACCAGCTCTTCGGCCGCCGCATCAAAGCCGCCCATCGAGCAGCGCATGCTGCTCGGCGCCG
CCGAGGTGGTCAGATACTGCGCGGCAAACACTATTCTCGCTGCGGCCGCTCCTTTGCTGATGCTGTTTGG
GCAACTCAGGCTGATGCCTGTCGAAAGACAGGCGGAGCCACTGGCGCAACATGTCGCTGAGGCCATCGAA
AAATTCGACCGGACGGTGGAGAAATCGGACGTTGCCGAAGAGGATGCGCGGATTGCGCGTTATGTTCTGT
GCGAAACAGCCGACGATCTTATCGGCAACCTGCCTTGGCCTGGGAAAGACGACTGGTCGCAACGCAGCAT
GTCGTGGCAGTTCTTTCATACCCAGTCCTCCGGCACAGGCTTCTACGAAGCACTGAACAAGATCCTGGCC
CATCCCGAGACACATTACGATCTGCTCGAACTGATGCATGTCTGTCTGTCGCTGGGGTTCGAGGGCCAGT
ATCGCGGCGTGAGGCGCGAAGACAACAATCTCGAGCGCGTTCGACGCGACGTCTACGAGACGCTTCGCTA
CTTCAGGACGCGTGCGGGTGAAGACATCTCGCCGCGCTGGCAGGGCTTGGCCGAGACGATGGCGCAGTCC
TCGGCCCGCCTGCCGCTTTGGGTGGTTGCCGCGTCAGCGTCGGCGCTGCTGGCGGCAGCGTTCTTCGCAT
TGCGGGTCTTCATCTCCAATGAAGGCGACGCCGCCGCAGGTGAATTGCTGGCACTCAACCCATCAATACC
CGTCGCTATCGAGCGCGCCAGCGTGGCGCCGCTGGTCGAGCCAGCCAAAGTCGCCCCACCGGCGGCCAAC
GCTCAGATCGATCGTATTCGTGCGGCGCTGGCCAAGGACGTCGAAGGCGGCGGACTGGCCATTGGCACCA
AGGGCGACTTCATCGTCGTGGAAATCAACAATCTGCTGCTGTTCCAGTCCGGCAGGGCCGAGACGAAGCC
GGAATTTCAGCCCATCGCCGCCGACATCGCCGCGGCTCTTGAGCACGAGCCTGGACCGATCCGGATCGTC
GGCCACACGGATAATGTCAAACCGCGTCGGTCGAGCGCCTTCAAATCCAACTTCGACCTTTCGCTGGCCC
GGGCCAAAGCCGTCGAAGCCCTGATGGCCGCGAAATTCAGCGATCCCTCGCGACTGACGGTGGACGGCAA
GGGCGAGGACGAACCGATCGCCGAAAACGCGACGCCGGAAGGCCGCGCCAGGAACCGCCGTGTCGATGTG
ATGATCCCCAGGGAGGAGACATTGTGA