SecReT6
Protein ID: 319778088
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6368
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]312068..313108 [-]
Producttype VI secretion system fha domain protein
NoteFha
UniProt IDE8TPV9
KEGG IDmci:Mesci_6368
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.40E-17, Aligned region: 29..94
Protein Sequence: 346 a.a.     [Download]
>gi|319778088|ref|YP_004134518.1| type VI secretion system fha domain protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
MHISLEINNVDALPAGTSTSYAARDRGFEIGRDACDWTLPDPDKFISGRHCEVRYEAGAFWLHDISRNGT
FINGSSQRMTGPHRLGHGDRILIGRYVILVSIDEERATAGYPSYKSEQRDMPPATGRPLEFKDAPFFDPA
QQRPGQRIPPHSPPLPSTRDEVLREIAIGAGISPELLQLRDPHEVAAEIGAVLRVVVEELTLLLKARAAA
KMLAKSTQRTMISAADNNPLKFVPGTDDILEIMFARRRAGYLDARRSIEDAFRDLKTHEFATYAAMQAAL
SRLLDDLSPEAIGRKLPPTSFTSKKGQAWDAYVATWRTMEEAHENGMLDIYLAYFSEAYAKADKQK
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|319777789|ref|NC_014918.1|:c313108-312068 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGCACATCAGTCTGGAAATCAACAATGTCGACGCCTTGCCCGCTGGTACCTCGACCAGCTACGCGGCGC
GTGATCGCGGCTTCGAAATCGGACGCGATGCTTGCGACTGGACCTTGCCGGATCCCGACAAGTTCATCTC
GGGCCGCCACTGCGAGGTTCGCTACGAGGCGGGCGCGTTCTGGCTGCACGACATCTCGCGCAATGGGACT
TTCATCAACGGATCGAGCCAGCGCATGACCGGGCCACACCGGCTTGGCCATGGCGACCGGATACTGATCG
GCCGTTATGTCATCTTGGTATCGATCGACGAAGAGCGCGCCACGGCGGGCTACCCCAGCTACAAATCCGA
GCAGCGAGACATGCCGCCCGCGACAGGCCGACCGCTGGAATTCAAAGATGCACCTTTCTTCGATCCCGCG
CAGCAACGGCCCGGGCAGCGCATTCCGCCGCACTCCCCACCCCTGCCTTCGACCAGAGACGAGGTCTTGC
GGGAGATCGCGATCGGAGCCGGCATTTCGCCGGAATTGCTTCAATTACGCGACCCGCATGAAGTTGCCGC
CGAAATCGGCGCGGTCCTGCGGGTGGTGGTCGAGGAACTGACGTTGCTGCTGAAAGCACGTGCGGCCGCG
AAAATGCTGGCCAAGAGCACACAACGAACGATGATCAGCGCCGCCGACAACAATCCGCTGAAGTTCGTTC
CAGGAACCGACGACATCCTCGAAATCATGTTCGCCCGTCGCAGGGCCGGCTATCTTGATGCCAGGCGCAG
TATCGAGGACGCATTCCGCGATCTGAAGACGCACGAATTCGCCACCTATGCCGCCATGCAAGCTGCGCTC
TCCCGACTGCTTGACGACCTGTCGCCCGAGGCGATCGGCAGGAAACTCCCGCCTACGTCGTTCACATCGA
AGAAGGGGCAGGCCTGGGACGCCTATGTCGCGACATGGCGGACCATGGAGGAGGCACATGAAAACGGCAT
GCTGGACATCTACCTGGCGTATTTCAGCGAGGCCTACGCCAAAGCCGACAAGCAAAAATAG