SecReT6
Protein ID: 319778089
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6369
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]313474..315801 [+]
Producttype VI secretion system vgr family protein
NoteTssI
UniProt IDE8TPW0, E8TPW0
KEGG IDmci:Mesci_6369
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.70E-78, Aligned region: 27..324
Phage_base_V [PF04717], Evalue: 5.90E-24, Aligned region: 365..457
Gp5_C [PF06715], Evalue: 2.10E-14, Aligned region: 500..519
Gp5_C [PF06715], Evalue: 2.10E-14, Aligned region: 523..546
Gp5_C [PF06715], Evalue: 2.10E-14, Aligned region: 548..562
Gp5_C [PF06715], Evalue: 2.10E-14, Aligned region: 563..586
Gp5_C [PF06715], Evalue: 2.10E-14, Aligned region: 571..594
Gp5_C [PF06715], Evalue: 2.10E-14, Aligned region: 588..610
Gp5_C [PF06715], Evalue: 2.10E-14, Aligned region: 607..626
Gp5_C [PF06715], Evalue: 2.10E-14, Aligned region: 624..642
Gp5_C [PF06715], Evalue: 2.10E-14, Aligned region: 644..665
Gp5_C [PF06715], Evalue: 2.10E-14, Aligned region: 672..689
Gp5_C [PF06715], Evalue: 2.10E-14, Aligned region: 703..714
Gp5_C [PF06715], Evalue: 2.10E-14, Aligned region: 749..762
Protein Sequence: 775 a.a.     [Download]
>gi|319778089|ref|YP_004134519.1| type VI secretion system vgr family protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
MPNERATVVRTPVGSELLTFTHLVGRDEISRCFAYTVGFVSTDSDIDPLKMLGGPLSIEAESDPKRWFSG
IVSEFRLTRLEDRLAYYEAVIRPWLWFLGNTTDCRIFQNKSVLDIVKDIFKKYGIAEFDLRLQGSYPPRE
YCVQYDEPDLDFVQRLLEHEGILYFFEHDDGKHTLVLADAMSKLKPAPGYEKVLYNFEGQGSRRDVEYIT
EWIPGSSVRPGAYAHTDYDFTKPGADLMAKSAQPFSHKEAAGENYRQPGAHLETGRGDSLAAIRREEIQA
VHQRIAAVGTVRGLYSGCTFKLDSFPREDQNQEYLVVSAEYRLFDPGYRAHADVNSENFKVILGLAPTAL
PYRPPRITPRPIMRGPQTATVVGPSGEEIFTDKYARVKVQFHWDRLGKKDQNSSCFVRVSQTWAGSGWGF
IQIPRIGQEVIVDFIEGDPDLPIITGRVYNASQMPPYGLPGSATQSGWKSDSSKGGGGYNELMFEDKAGS
ELVNFQAQKDHILLVKHDRTKLVQHDQSDRIDHDAKHSVGHNLDEDVGNNKTVKIGVDQTTNIGSNDTET
VGANRSLTVMANETIHVVSNSTENIDANHTQTVGIVQTVSVGAARVDTVGASETRSVGGPQTNTIGATRS
VTVGAAQDHSIGASDSWTIASDQSVSIGGGHTESIAKDQGSTVGGGRTASVGKDDSTSVAGAHSLSVGKD
SAISVTGNGTIKIGKKLVIDAGDEILITTGSAKIMMKKDGTIAIEGKDISVKGSGKISIKASSDITMKGS
KIGEN
 
Nucleotide Sequence: 2328 bp     [Download]
>gi|319777789|ref|NC_014918.1|:313474-315801 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGCCCAATGAACGTGCCACCGTTGTCCGGACACCGGTTGGCTCCGAGCTGTTGACCTTCACGCATCTTG
TCGGACGCGATGAGATCAGCCGTTGTTTTGCCTATACGGTCGGATTCGTGAGCACCGACTCCGATATCGA
TCCGTTGAAGATGCTGGGCGGGCCGCTCTCGATCGAAGCTGAATCTGATCCGAAACGCTGGTTCAGCGGC
ATCGTCTCCGAGTTCCGGCTCACCCGGCTGGAAGATCGGCTGGCCTACTATGAGGCGGTCATCAGGCCGT
GGCTCTGGTTTCTCGGCAACACCACCGATTGCCGTATTTTCCAGAACAAGAGCGTCCTCGACATCGTCAA
GGACATCTTCAAGAAATACGGTATCGCGGAATTCGATCTGCGCCTGCAAGGGTCCTATCCCCCGCGCGAA
TATTGCGTGCAGTACGACGAACCCGATCTGGATTTCGTGCAGCGGCTGCTGGAGCATGAAGGCATCCTGT
ATTTCTTCGAGCATGATGACGGCAAGCACACGCTTGTCCTGGCCGATGCGATGAGCAAGCTGAAGCCTGC
GCCGGGCTACGAGAAAGTGCTCTATAACTTTGAAGGTCAGGGTTCGCGGCGCGATGTCGAATACATCACT
GAATGGATACCGGGCAGTTCGGTGCGCCCAGGCGCCTATGCCCACACTGACTATGATTTCACGAAGCCGG
GCGCCGATCTCATGGCCAAGTCGGCCCAGCCGTTCAGCCACAAGGAGGCAGCGGGTGAGAACTACCGCCA
GCCCGGCGCGCATCTCGAAACGGGCCGGGGAGACAGCCTGGCCGCGATCCGGCGTGAGGAAATCCAGGCC
GTCCACCAGCGCATCGCCGCTGTCGGCACCGTGCGCGGCCTCTATTCGGGCTGCACGTTCAAGCTGGATA
GCTTTCCGCGTGAGGACCAGAACCAGGAGTATCTGGTGGTCAGCGCCGAATACAGACTGTTTGATCCAGG
TTACAGAGCCCATGCTGACGTCAACAGCGAGAATTTCAAGGTGATCCTCGGCCTGGCGCCGACAGCCTTG
CCCTATCGTCCGCCGCGGATCACGCCACGGCCGATCATGCGTGGCCCCCAGACGGCGACGGTGGTCGGCC
CGTCCGGCGAGGAAATATTTACCGACAAATATGCGCGGGTGAAGGTGCAGTTTCATTGGGACCGTCTGGG
CAAGAAGGACCAGAACAGCTCCTGTTTCGTGCGGGTGTCGCAGACCTGGGCCGGCAGCGGCTGGGGCTTC
ATCCAGATCCCGCGCATCGGCCAGGAGGTGATCGTCGACTTCATCGAAGGCGACCCGGACCTGCCGATCA
TTACCGGCAGGGTCTACAACGCCTCCCAGATGCCGCCCTACGGGCTGCCGGGCAGCGCCACGCAATCGGG
CTGGAAGTCCGACTCCTCCAAAGGCGGTGGCGGCTACAACGAGCTGATGTTCGAGGACAAGGCCGGCTCC
GAACTGGTCAATTTCCAGGCGCAGAAGGACCACATCCTTCTGGTCAAGCACGACCGCACCAAGCTGGTGC
AGCACGACCAGTCCGACCGCATCGACCACGACGCCAAGCATTCCGTCGGCCACAACCTCGATGAGGACGT
CGGTAACAACAAGACGGTCAAGATCGGCGTCGACCAGACCACCAACATCGGCTCGAACGACACCGAGACA
GTGGGCGCCAACCGCTCGCTGACGGTCATGGCCAACGAGACCATCCATGTCGTGTCGAACTCGACGGAGA
ACATCGACGCCAATCACACGCAGACGGTGGGGATTGTGCAGACGGTGAGCGTTGGCGCTGCGCGTGTCGA
TACGGTCGGAGCATCGGAGACCAGAAGCGTCGGCGGGCCGCAGACCAACACGATCGGCGCGACACGGTCC
GTGACGGTTGGGGCAGCGCAGGACCACAGCATAGGTGCGAGCGACAGCTGGACGATTGCTTCCGATCAGA
GCGTGTCCATAGGCGGCGGCCACACCGAGAGCATCGCGAAGGATCAAGGTTCGACGGTCGGCGGAGGACG
CACCGCTTCGGTAGGCAAGGACGATTCGACATCGGTGGCCGGCGCGCATTCCCTCTCGGTCGGCAAAGAC
AGTGCCATTTCTGTCACCGGCAATGGCACGATCAAAATCGGCAAGAAGCTGGTCATCGACGCCGGTGACG
AAATTCTCATCACAACCGGCTCGGCCAAGATCATGATGAAGAAAGACGGCACGATCGCGATCGAGGGCAA
GGACATTTCGGTCAAAGGGTCAGGAAAGATCAGCATCAAGGCTTCTAGCGACATCACGATGAAGGGTTCG
AAAATAGGGGAGAACTAG

Protein ID: 319778090
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6370
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]315805..316230 [+]
Producthypothetical protein
NoteTssI
UniProt IDE8TPW1, E8TPW1
KEGG IDmci:Mesci_6370
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 141 a.a.     [Download]
>gi|319778090|ref|YP_004134520.1| hypothetical protein Mesci_6370 [Mesorhizobium ciceri biovar biserrulae WSM1271]
MEKVRDRVDGVVIGQFLGFGEDGPLVVFPGNSKETALAARSLAELSSDMIGQEIALLFEDGDARRPLIVG
RIVELVRKHAAPAVIRDGDRVRIHAEERIELRCGKATILMEKDGRITIRGTFVTSHASAANRIRGGSIDL
N
 
Nucleotide Sequence: 426 bp     [Download]
>gi|319777789|ref|NC_014918.1|:315805-316230 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGGAAAAGGTTCGTGATCGCGTCGATGGCGTCGTAATTGGCCAGTTTCTCGGTTTCGGCGAAGACGGTC
CTCTGGTAGTATTTCCGGGCAATTCGAAAGAAACCGCACTAGCGGCGCGCAGCCTTGCCGAACTGTCATC
CGATATGATCGGCCAGGAGATCGCCTTGTTGTTCGAGGACGGAGATGCGCGGCGGCCGCTCATCGTCGGG
CGCATCGTGGAACTGGTGCGCAAGCATGCGGCACCTGCAGTTATTCGCGATGGAGACCGCGTGCGGATTC
ACGCCGAAGAACGGATCGAATTACGCTGCGGCAAGGCAACGATCCTGATGGAGAAAGACGGTCGCATCAC
CATCAGAGGTACTTTCGTTACCAGCCACGCCAGTGCCGCCAACCGTATTCGCGGCGGTTCGATCGACTTA
AATTGA