SecReT6
Protein ID: 319778090
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6370
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]315805..316230 [+]
Producthypothetical protein
NoteTssI
UniProt IDE8TPW1, E8TPW1
KEGG IDmci:Mesci_6370
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 141 a.a.     [Download]
>gi|319778090|ref|YP_004134520.1| hypothetical protein Mesci_6370 [Mesorhizobium ciceri biovar biserrulae WSM1271]
MEKVRDRVDGVVIGQFLGFGEDGPLVVFPGNSKETALAARSLAELSSDMIGQEIALLFEDGDARRPLIVG
RIVELVRKHAAPAVIRDGDRVRIHAEERIELRCGKATILMEKDGRITIRGTFVTSHASAANRIRGGSIDL
N
 
Nucleotide Sequence: 426 bp     [Download]
>gi|319777789|ref|NC_014918.1|:315805-316230 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGGAAAAGGTTCGTGATCGCGTCGATGGCGTCGTAATTGGCCAGTTTCTCGGTTTCGGCGAAGACGGTC
CTCTGGTAGTATTTCCGGGCAATTCGAAAGAAACCGCACTAGCGGCGCGCAGCCTTGCCGAACTGTCATC
CGATATGATCGGCCAGGAGATCGCCTTGTTGTTCGAGGACGGAGATGCGCGGCGGCCGCTCATCGTCGGG
CGCATCGTGGAACTGGTGCGCAAGCATGCGGCACCTGCAGTTATTCGCGATGGAGACCGCGTGCGGATTC
ACGCCGAAGAACGGATCGAATTACGCTGCGGCAAGGCAACGATCCTGATGGAGAAAGACGGTCGCATCAC
CATCAGAGGTACTTTCGTTACCAGCCACGCCAGTGCCGCCAACCGTATTCGCGGCGGTTCGATCGACTTA
AATTGA