SecReT6
Protein ID: 319778100
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6380
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]326997..328331 [-]
Producttype VI secretion protein, vc_a0114 family
NoteTssK
UniProt IDE8TPX1, E8TPX1
KEGG IDmci:Mesci_6380
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.40E-116, Aligned region: 19..442
Protein Sequence: 444 a.a.     [Download]
>gi|319778100|ref|YP_004134530.1| type VI secretion protein, vc_a0114 family [Mesorhizobium ciceri biovar biserrulae WSM1271]
MSNANRVLWSEGLFLRTQHFQQQDRFFEATVRGALQAGQLHTFGFQQLTLDQALLEAGQISILSARGIFP
DGTPFSIPDMMDAPRPLPVTPDTGAGPVLIALPLEPPGGVGFDPAHAAASGARYHGRIVSVRDAVQGGSD
PEEIEIARPQALLLAPGKSVGGYTALPIADLKGIRADGGVSLDETFLPPTLVTGAVAWYRQLLLEVVTGL
DQIAEAHGKMVMGGPGRSVEDLLMLNLANAARPRLAHMLAQDVFHPAELYLELAGLAGSMATYGSSARRL
GELPAYDHMAPGPAYSALADALRSLILSLRYIEPKSRALPVMRHSTNVWKIRIDNPKLLVASRIVIRVGS
ELSEDALRKIFVNQATVGSADQFEGLWKSRLPGIPLKPLHSQPREIPYDGDRLCLELDQKSEHWASLLDA
PGFVIGVSGVLPSEPQVDCYSVNR
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|319777789|ref|NC_014918.1|:c328331-326997 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGAGCAATGCAAACAGGGTGCTATGGTCCGAAGGGCTTTTCCTGCGGACCCAGCATTTCCAGCAGCAGG
ATCGCTTTTTCGAGGCGACGGTGCGCGGCGCGTTGCAGGCCGGGCAATTGCATACGTTCGGTTTCCAACA
GCTGACGCTGGACCAGGCGTTGCTGGAAGCCGGCCAGATCTCGATCCTGTCCGCGCGGGGCATCTTTCCG
GATGGGACACCTTTTTCCATCCCGGACATGATGGACGCGCCGCGACCGCTGCCGGTCACCCCTGACACGG
GCGCCGGACCGGTGCTGATCGCCTTGCCGCTGGAGCCTCCGGGCGGTGTCGGCTTCGATCCGGCACACGC
TGCCGCCTCGGGTGCGCGATATCATGGGCGGATCGTTTCGGTGCGTGACGCCGTCCAGGGCGGTTCAGAC
CCTGAAGAAATCGAAATTGCCCGGCCGCAGGCGCTGCTGCTCGCACCCGGCAAGTCGGTCGGTGGCTACA
CGGCCTTGCCGATCGCCGACCTCAAGGGGATTCGAGCCGATGGCGGCGTCTCCCTGGACGAGACCTTCCT
GCCACCGACCTTGGTTACGGGCGCCGTGGCCTGGTACCGGCAATTGCTGCTGGAAGTTGTCACCGGCCTC
GACCAGATCGCCGAGGCGCATGGCAAGATGGTCATGGGCGGACCTGGGCGCAGCGTCGAAGATTTGCTGA
TGCTCAATCTCGCCAATGCGGCACGTCCGCGGCTGGCCCACATGCTGGCTCAGGATGTGTTCCATCCAGC
CGAGCTTTACCTGGAACTTGCCGGTCTCGCCGGTTCGATGGCGACCTACGGATCGAGCGCGCGGCGGCTG
GGCGAGTTGCCCGCCTACGATCACATGGCGCCTGGCCCCGCCTATTCGGCGCTGGCGGATGCGCTGCGCT
CGCTCATCCTCAGCCTGCGTTACATCGAGCCCAAATCGCGTGCGCTGCCTGTCATGCGGCATTCGACCAA
TGTCTGGAAGATCCGCATCGACAATCCGAAGCTGCTGGTGGCCAGCCGGATCGTCATCCGGGTCGGTTCG
GAGTTGTCGGAAGACGCGCTGCGCAAGATATTCGTCAATCAGGCAACCGTCGGCTCGGCCGACCAGTTCG
AGGGCCTGTGGAAATCGCGCTTGCCCGGCATTCCGCTGAAACCGCTTCATTCCCAGCCGCGCGAGATTCC
TTACGATGGCGATCGGTTATGCCTGGAACTGGACCAGAAAAGTGAGCACTGGGCGTCGCTGCTCGACGCT
CCCGGCTTCGTCATCGGCGTTTCGGGCGTGTTGCCAAGCGAGCCGCAGGTGGACTGCTATTCGGTGAACA
GGTGA