SecReT6
Protein ID: 319778101
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6381
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]328372..328824 [-]
Producttype VI secretion lipoprotein, vc_a0113 family
NoteTssJ
UniProt IDE8TPX2, E8TPX2
KEGG IDmci:Mesci_6381
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.90E-27, Aligned region: 16..147
Protein Sequence: 150 a.a.     [Download]
>gi|319778101|ref|YP_004134531.1| type VI secretion lipoprotein, vc_a0113 family [Mesorhizobium ciceri biovar biserrulae WSM1271]
MIDRREFVVALGATGLLAACQSGPPKPSVITVNVTGGAGMNPGPGGGDRPVTILVMRLKSTGKFNSADYF
ALQGDTGTALAGDLIGSDQISVGPGKSASKTITVEPDATALGFVALIREPGGRNWRTTKSVSSGSKFTIN
VTLGSGGISA
 
Nucleotide Sequence: 453 bp     [Download]
>gi|319777789|ref|NC_014918.1|:c328824-328372 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGATTGATCGACGTGAATTTGTTGTTGCCTTGGGCGCGACAGGGTTGCTTGCGGCTTGCCAGAGTGGTC
CGCCGAAACCATCGGTGATCACCGTCAACGTAACCGGCGGTGCTGGCATGAACCCGGGACCAGGCGGCGG
CGACCGGCCGGTAACGATCCTGGTGATGCGGCTGAAAAGCACCGGCAAATTCAATTCCGCCGACTATTTC
GCGCTGCAGGGGGATACCGGCACGGCGCTGGCGGGCGATCTCATCGGATCCGACCAGATTTCCGTCGGGC
CGGGAAAATCCGCATCCAAAACCATCACGGTCGAGCCGGACGCGACGGCGCTGGGCTTTGTTGCTCTGAT
CCGCGAGCCCGGCGGCCGGAACTGGCGGACAACCAAGTCGGTGTCGTCGGGATCGAAATTCACGATCAAC
GTCACGCTTGGCAGCGGCGGCATTTCCGCCTAG