SecReT6
Protein ID: 319778102
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6382
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]328828..330300 [-]
Producttype VI secretion system fha domain protein
NoteFha
UniProt IDE8TPX3
KEGG IDmci:Mesci_6382
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 7.00E-12, Aligned region: 27..95
Protein Sequence: 490 a.a.     [Download]
>gi|319778102|ref|YP_004134532.1| type VI secretion system fha domain protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
MSLLLTLEQGPRTQAVRQARLDEGELVIGRSADAGWQINDPDMFVSRAHCKISGGRDGYFVTDTSSSGLF
INDSDSPLGAGKSTRLQSGMRLRLGDYVVHVDLQTPATQAPAAGQPVSERAPPASRAPVSIGRDDFFSAK
VEEEPRRPRPADLPNPFEQPVAGAFERANSDQRHSAAFDDPFSLDPVSTPVSKNPAPYREPGGAASQADP
FSLDAVPSPDRAAQAARDKPSGTHDDFAFGPAATLSSANGASSIEQRERIAQRSQSANPWDLPVQPAATP
ASPRVGAAPKGAPALAAARPEEMALRAAFLHGMGVEEADFPGRDCIAEMEKFGREYRMMMEGLMQLLRKR
AEEKGNARVAQTMVGASEVNPLKFLPTVDDAIITLIAERSPGFLGGEAAITDAVRDLAQHHVRAWRGIQT
AMRRMIDRFDPVVIEEELKSNSAIGTLLSGGRGAKLWELYQKRHREIAESAEKSFLGEIGADFRDAYEEE
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|319777789|ref|NC_014918.1|:c330300-328828 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGAGCCTGCTGCTGACACTGGAGCAAGGGCCACGCACCCAGGCGGTGCGGCAGGCCCGGCTTGACGAGG
GTGAGCTGGTGATCGGCCGCAGCGCGGACGCGGGTTGGCAGATCAACGATCCCGACATGTTCGTTTCAAG
GGCACATTGCAAGATCTCTGGCGGGCGAGATGGATATTTCGTCACCGACACGTCGAGCAGCGGATTGTTC
ATAAACGACTCCGACAGCCCGCTCGGTGCCGGCAAGTCGACGCGCCTTCAAAGTGGCATGCGGCTGAGAT
TGGGCGACTACGTCGTCCATGTCGACCTGCAAACGCCAGCCACTCAAGCACCAGCGGCCGGCCAGCCGGT
TTCGGAACGCGCGCCGCCAGCATCCCGGGCCCCGGTGAGCATCGGTCGCGATGACTTCTTTTCCGCCAAG
GTCGAAGAAGAGCCGCGACGGCCACGTCCGGCCGATCTGCCGAACCCTTTCGAGCAGCCGGTTGCGGGTG
CATTCGAACGTGCCAACTCCGACCAGCGCCACTCGGCCGCTTTCGATGACCCGTTCAGCCTCGATCCGGT
TTCGACGCCGGTGTCGAAAAATCCCGCCCCTTATCGCGAACCGGGCGGCGCGGCGAGCCAAGCGGACCCG
TTCAGCCTCGACGCGGTACCGTCCCCCGACCGCGCAGCCCAAGCTGCCCGTGACAAGCCGTCCGGAACCC
ATGATGACTTTGCTTTCGGACCAGCCGCCACGCTCAGTTCGGCGAACGGCGCCAGTTCGATCGAACAGCG
CGAGCGCATCGCCCAGCGATCCCAATCAGCCAATCCCTGGGATTTGCCGGTGCAGCCCGCAGCTACCCCT
GCATCACCACGTGTGGGTGCTGCTCCCAAAGGCGCCCCGGCGCTGGCTGCGGCGCGGCCGGAGGAGATGG
CGCTTCGCGCCGCATTCCTGCATGGCATGGGTGTCGAGGAAGCCGATTTCCCCGGACGCGACTGCATCGC
GGAAATGGAGAAGTTCGGTCGCGAATACCGGATGATGATGGAAGGCCTGATGCAGCTTCTGCGCAAGCGG
GCCGAGGAAAAGGGAAACGCGCGCGTCGCGCAGACCATGGTCGGGGCCTCCGAAGTCAATCCGCTCAAGT
TCCTGCCGACCGTCGACGACGCCATCATAACGCTTATCGCTGAGCGCAGCCCAGGATTTCTCGGCGGTGA
AGCGGCAATCACCGATGCGGTGCGCGATCTCGCGCAACATCACGTACGCGCCTGGCGAGGCATACAGACC
GCCATGCGGCGGATGATCGACCGTTTTGACCCGGTAGTGATCGAGGAAGAGCTGAAATCGAATTCCGCGA
TCGGAACCCTTCTCTCTGGGGGGCGGGGCGCCAAGCTGTGGGAACTTTACCAGAAGCGCCATCGTGAAAT
CGCCGAGAGTGCTGAAAAGAGCTTCCTTGGCGAAATCGGCGCTGATTTTCGAGATGCATATGAGGAGGAG
TGA