SecReT6
Protein ID: 319778103
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6383
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]330297..331364 [-]
Producttype VI secretion protein, vc_a0111 family
NoteTssG
UniProt IDE8TPX4, E8TPX4
KEGG IDmci:Mesci_6383
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.70E-86, Aligned region: 25..327
Protein Sequence: 355 a.a.     [Download]
>gi|319778103|ref|YP_004134533.1| type VI secretion protein, vc_a0111 family [Mesorhizobium ciceri biovar biserrulae WSM1271]
MADDARQSLPDLDKPGPNRAEGLSETFDFFELLRRLEQRNGLFGHSGRPDREPARLGQHVRLAFSARDLV
VFREARDAAPARVTVANFGLLGPEGPMPLHLTRWVLDRLSQRWFAGAEAQLTSDTTFVDFVNILQHRMIA
LYYRAWADAHPAVQAERAVGGRVRAMLEAMAGIGLPGTQDPNLDTVKLRQAASLANQVDGPERLTLFLAE
AFKAPVQIKEFISAWITVPTGLQTRLAKAFAGLGKGATIGPRVFSRQSRIELRVGPLGYEEFKAFLPGGE
RLKLFKQAVRDMVGESLDVDLRIVLAREAVPPPQIGAVRLGRTAWLARPIERGDADDMRLRTIVGWRPEM
TGVAA
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|319777789|ref|NC_014918.1|:c331364-330297 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGGCCGATGACGCCCGGCAATCGCTACCTGATCTAGACAAGCCCGGCCCGAACAGGGCCGAAGGTCTGT
CCGAGACGTTCGACTTTTTCGAACTGCTGCGCCGCCTCGAACAACGGAACGGTCTGTTCGGCCATTCCGG
CCGTCCCGACCGTGAGCCGGCACGGCTCGGCCAGCATGTGCGCCTCGCCTTTTCCGCACGGGACCTGGTT
GTGTTCCGCGAAGCCCGCGATGCGGCACCGGCCCGGGTCACGGTGGCAAATTTTGGTCTGCTGGGACCCG
AGGGTCCAATGCCGCTGCATCTGACGCGCTGGGTGCTCGACCGGCTCTCGCAACGCTGGTTCGCCGGCGC
CGAGGCACAACTGACCAGCGACACGACGTTCGTCGACTTCGTCAACATTCTGCAGCACCGTATGATCGCC
CTCTACTATCGGGCCTGGGCGGATGCGCACCCGGCCGTGCAGGCCGAACGCGCGGTCGGCGGGCGCGTTC
GCGCCATGCTTGAAGCCATGGCCGGGATCGGACTTCCCGGCACGCAGGACCCCAATCTCGATACGGTGAA
GCTTCGCCAGGCGGCTTCGCTGGCCAATCAGGTCGACGGCCCGGAACGGCTGACGCTGTTCCTGGCGGAA
GCGTTCAAGGCGCCGGTACAGATCAAGGAGTTCATCTCCGCCTGGATAACAGTACCAACCGGTCTCCAGA
CCCGTCTTGCAAAGGCCTTTGCAGGGCTCGGCAAGGGCGCGACGATCGGCCCACGCGTTTTCAGCCGCCA
AAGCAGGATCGAACTGCGTGTCGGCCCGCTGGGGTATGAGGAGTTCAAGGCGTTCCTGCCTGGCGGCGAG
CGGCTCAAGCTGTTCAAGCAGGCCGTTCGCGACATGGTCGGGGAGTCGCTCGACGTCGATCTGCGCATCG
TGCTTGCGCGTGAAGCCGTACCGCCGCCCCAAATCGGAGCGGTTCGGCTCGGGCGGACCGCCTGGCTTGC
GCGACCCATCGAAAGGGGCGATGCTGACGACATGCGGCTGCGGACAATCGTCGGATGGCGGCCGGAAATG
ACGGGGGTCGCGGCATGA