SecReT6
Protein ID: 319778104
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6384
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]331328..333202 [-]
Producttype VI secretion protein, vc_a0110 family
NoteTssF
UniProt IDE8TPX5, E8TPX5
KEGG IDmci:Mesci_6384
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-166, Aligned region: 6..624
Protein Sequence: 624 a.a.     [Download]
>gi|319778104|ref|YP_004134534.1| type VI secretion protein, vc_a0110 family [Mesorhizobium ciceri biovar biserrulae WSM1271]
MDRVFVEYYEEELSHIRALASEFADMHPAVARNLSLDTVPCPDPYVERLLDGVAFLAARTRLKVDAERSR
FSRSVLDVLYPDLVTPAPATAMAVLKPGQQVQTMLAGHVVKRNTRLVSSLQPGLSTRCIFSTAQEMTLWP
IAVTSVSFFQDRSAMAMAGIGPIGGVSGESALRLTLARTGKGKLDELALDRLDLYFAGRTKAPLLFDAIF
GACAATAARPEGKTNPLSPLPAPEMIGISDDEALMPRTRPTFEGYRLLREYFMMPERFHYARVLGLQPVV
RQCAAGLEIIFLFKRTVPELADLTPADFELFATPIINLFERECNVVEVDERKTRQVLHADRTRARDFEIY
RVIRVEDADTEGNDAEIPELFSLGQNRGSGWVYSTERRPRRAMEEERREGLTRTSYTGDDVFLAVSRPLV
RPATRPLKRLDVMALCTNRDLPILDDNPTLTLEAGDPVETVRLLGALRAPQPAIPAALPAGADGESRADD
LAWRLVAQLALNFLSLAKEGRGIDPLHALLDLYADRGDPSLARNVHSIVRIDSQPVIERLQIDGPMCFGR
GTEVTLHVDQSVLAGQSTLLLSALLARLFARHAGINGFVRTRTRLLQKQEDVPWPMTPGNRYLI
 
Nucleotide Sequence: 1875 bp     [Download]
>gi|319777789|ref|NC_014918.1|:c333202-331328 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGGATCGGGTCTTCGTCGAATATTACGAGGAGGAACTGAGCCATATCCGCGCTCTTGCATCGGAATTCG
CAGACATGCATCCGGCGGTGGCGCGCAACCTTTCCCTCGATACGGTGCCGTGTCCGGACCCATATGTCGA
GCGCCTGCTCGATGGCGTAGCCTTCCTGGCCGCGCGCACCCGGCTAAAGGTCGATGCCGAGCGCTCGCGA
TTTTCCCGCAGTGTGCTCGACGTTCTCTATCCCGATCTGGTCACGCCGGCGCCGGCAACGGCGATGGCGG
TGCTGAAACCCGGCCAGCAGGTCCAGACCATGCTGGCCGGCCACGTCGTCAAGCGCAACACACGGCTGGT
TTCCAGCCTGCAGCCAGGCCTGTCAACGCGCTGCATTTTCTCAACCGCCCAGGAAATGACTCTATGGCCG
ATCGCGGTCACTTCGGTCAGCTTTTTTCAGGACCGCAGTGCGATGGCGATGGCTGGCATAGGACCGATCG
GCGGTGTCAGCGGCGAGTCGGCGCTCCGCCTCACGCTGGCCAGGACCGGAAAAGGCAAGCTCGACGAACT
GGCTCTCGACCGGCTTGACCTCTATTTTGCCGGACGCACCAAGGCGCCGCTACTGTTCGATGCGATTTTC
GGCGCCTGCGCGGCCACAGCAGCGCGACCGGAAGGCAAGACCAACCCGCTGTCGCCGTTGCCGGCACCCG
AGATGATCGGCATCAGCGACGACGAGGCCTTGATGCCGCGCACCCGCCCGACATTCGAAGGATACCGGTT
GCTGCGCGAATACTTCATGATGCCCGAGCGTTTTCACTATGCACGGGTTTTGGGATTGCAGCCTGTCGTG
CGCCAATGCGCGGCCGGACTCGAGATCATTTTCCTGTTCAAACGCACGGTTCCCGAGCTGGCCGATCTGA
CGCCGGCGGACTTCGAACTTTTCGCGACACCGATCATCAATCTGTTCGAACGCGAGTGCAACGTCGTCGA
AGTCGATGAACGCAAGACGCGCCAGGTGTTGCATGCGGACCGGACGCGGGCGCGTGACTTCGAAATCTAC
CGGGTCATCCGCGTCGAGGACGCCGACACGGAAGGCAACGACGCCGAAATCCCCGAGCTCTTCAGCCTGG
GTCAGAACCGCGGTAGTGGTTGGGTCTATTCGACCGAAAGGCGCCCTCGCCGCGCGATGGAGGAGGAGCG
CCGCGAAGGCCTGACGCGAACGTCCTATACCGGGGATGACGTTTTCCTGGCCGTGTCCCGGCCGCTCGTA
AGGCCGGCGACCCGGCCGCTGAAGCGGCTCGACGTGATGGCGCTTTGCACCAATCGTGATCTGCCGATCC
TCGATGACAATCCGACGTTGACGTTAGAGGCCGGCGACCCGGTCGAAACCGTGAGGCTTCTTGGCGCCTT
GCGTGCGCCGCAGCCAGCCATTCCTGCGGCACTGCCTGCTGGGGCCGACGGGGAATCGCGGGCCGATGAT
CTCGCCTGGCGGCTGGTGGCGCAGCTCGCGCTCAACTTTCTCAGTCTTGCCAAAGAAGGCCGCGGCATCG
ATCCCCTGCATGCGCTACTCGACCTTTATGCCGATCGCGGCGATCCAAGCCTTGCCCGAAATGTGCATTC
GATCGTGCGTATCGACTCGCAGCCGGTCATCGAACGTCTGCAAATCGATGGACCGATGTGCTTTGGACGC
GGTACCGAAGTCACGTTGCATGTTGATCAATCGGTCCTGGCCGGCCAAAGTACCTTGCTGCTTTCGGCCT
TGCTGGCGCGGTTGTTTGCTCGTCACGCCGGGATAAACGGCTTCGTGCGAACTCGCACGCGGCTGCTGCA
GAAGCAGGAGGATGTGCCATGGCCGATGACGCCCGGCAATCGCTACCTGATCTAG