SecReT6
Protein ID: 319778105
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6385
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]333204..333959 [-]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDE8TPX6, E8TPX6
KEGG IDmci:Mesci_6385
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.80E-26, Aligned region: 107..232
Protein Sequence: 251 a.a.     [Download]
>gi|319778105|ref|YP_004134535.1| type VI secretion system lysozyme-related protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
MSASEVRRPGAGMQQTTGSLRAKSEAVQPSLWDRLVNDLPGLTSEIDGLRHVLLDELGADRLDTLVAGST
RAIDADVVLTPDQKRRLHRLAVQTQHRVEIESRGVVVSARVLREAVRRDIEALFNTERFEATPLLSDLEN
EQVADNPPSLADFPEVRRSVVNYGVPSFSGRSSRDFDREVLAREIRMVLATFEPRLKESATKVTVTLGDN
TVGLKIEIDAVLIMTPTPERMRLRTTINLDNGLARTEIGEA
 
Nucleotide Sequence: 756 bp     [Download]
>gi|319777789|ref|NC_014918.1|:c333959-333204 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGTCGGCAAGTGAGGTTCGGCGACCCGGCGCGGGCATGCAGCAGACCACTGGCAGCTTGCGGGCGAAAA
GCGAAGCCGTCCAGCCGTCGCTTTGGGATCGTCTCGTCAATGATCTGCCGGGCCTGACCTCGGAAATAGA
CGGGCTGCGCCATGTCCTGCTCGACGAGCTTGGCGCGGACCGTCTCGACACACTCGTTGCCGGCAGCACG
CGTGCCATCGACGCCGATGTGGTACTGACACCGGATCAGAAACGCCGTCTGCATCGGTTGGCCGTTCAGA
CCCAGCACCGCGTCGAAATCGAAAGCCGTGGCGTGGTGGTATCGGCGCGCGTGCTCAGGGAAGCGGTACG
GCGTGACATCGAGGCGCTCTTCAACACAGAGCGCTTCGAGGCGACGCCGCTTCTTTCCGACCTGGAAAAT
GAACAGGTTGCGGACAATCCCCCTTCGCTTGCCGATTTCCCGGAGGTCCGCCGCAGCGTGGTCAATTACG
GCGTGCCCTCCTTCTCGGGCCGCTCGTCGCGCGACTTCGATCGCGAGGTGTTGGCACGTGAGATCCGCAT
GGTGCTCGCGACCTTCGAGCCCCGCCTGAAGGAAAGCGCAACAAAGGTAACGGTCACGCTTGGCGACAAC
ACCGTCGGCCTGAAGATCGAGATAGACGCCGTTCTGATCATGACCCCGACTCCCGAACGCATGCGCCTGC
GCACCACGATCAATCTCGACAACGGTTTGGCGCGGACCGAAATTGGGGAGGCCTGA