SecReT6
Protein ID: 319778106
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6386
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]333946..334404 [-]
Producttype VI secretion system effector, hcp1 family
NoteTssD
UniProt IDE8TPX7, E8TPX7
KEGG IDmci:Mesci_6386
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.90E-34, Aligned region: 9..138
Protein Sequence: 152 a.a.     [Download]
>gi|319778106|ref|YP_004134536.1| type VI secretion system effector, hcp1 family [Mesorhizobium ciceri biovar biserrulae WSM1271]
MPTTKIDGFLKVPDIKGPSTRDGHDDEIEIHGVDYKMVAPYDPNSLSRRGRVSMGMIKFTKHYDKSSPYL
KKALFENKALDEVVFSARRTIDGETKDYLVVTLTDASIMEYDMSQAEDEEDLIQEEVSFAYKKIKFVYDG
NDEAEMDVYVGK
 
Nucleotide Sequence: 459 bp     [Download]
>gi|319777789|ref|NC_014918.1|:c334404-333946 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGCCGACTACGAAGATTGATGGCTTCCTGAAGGTTCCCGATATCAAAGGCCCCAGCACCCGCGACGGCC
ACGATGACGAGATTGAAATCCATGGCGTCGACTACAAGATGGTCGCACCTTATGATCCCAATTCGCTGTC
ACGCCGTGGCCGCGTCTCCATGGGGATGATCAAATTCACCAAGCACTACGACAAATCATCGCCCTATCTG
AAAAAGGCTTTGTTCGAAAACAAGGCCCTTGATGAGGTGGTGTTCTCGGCCCGCCGGACCATCGATGGCG
AGACCAAGGATTACCTGGTCGTTACCCTCACCGACGCCTCGATCATGGAATACGACATGTCGCAGGCCGA
GGATGAGGAAGACCTGATCCAGGAAGAGGTCAGCTTCGCCTACAAGAAGATCAAATTCGTCTATGACGGC
AATGATGAAGCCGAAATGGATGTCTATGTCGGCAAGTGA