SecReT6
Protein ID: 319778107
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6387
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]334451..335962 [-]
Producttype VI secretion protein, evpb/vc_a0108 family
NoteTssC
UniProt IDE8TNT4, E8TNT4
KEGG IDmci:Mesci_6387
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.90E-176, Aligned region: 70..499
Protein Sequence: 503 a.a.     [Download]
>gi|319778107|ref|YP_004134537.1| type VI secretion protein, evpb/vc_a0108 family [Mesorhizobium ciceri biovar biserrulae WSM1271]
MIMAEQQKTASVAAEAEAINLDEFSGLLEKDFKVKKDDSEKLQQLVRNLALAAQSRSDTTTISSNAIKSI
KSLIAGIDKMLTTQVNEILHAPEVREMEGTWRGLWYLVNNTETDQKLKIRVMNISKEQLADTLEDYEGQM
WDQSPIFKKVYTDEYSMLGGEPIGCVIGAYEFSNHPRDVGLLRNISGICASAHTPFIAAASPRLFRMDSW
QELPNPQDLQQIVSNPAYASWQSLRESEDARYIGLTMPRVLARLPYGTDTVPVKGFTFEEEVEGDHNKYV
WMNAAFPMGVNINRSHKLFGWGTQIRGVENGGTVLNLPVHSFPTDDGSIAMKCPTEVAIDDRREAELAKL
GLMPILHRKNTDLAAFIGAHSLQDDETRAGRLVDPDAQSNERLSANLPYLFPVSRFAHYLKAIARDKVGS
FKERADMQIWLTEWINRYVLANPAFADDKARAKRPLAAAEVQVDSVEGRPGYYNARFYLRPHYQLEGINA
SLRLVSELPSVKT
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|319777789|ref|NC_014918.1|:c335962-334451 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGATCATGGCCGAACAGCAAAAGACCGCCTCAGTCGCCGCGGAGGCCGAAGCCATAAACCTCGATGAAT
TCAGCGGACTCCTCGAAAAAGATTTCAAGGTCAAGAAGGACGACAGCGAGAAGCTGCAACAGCTCGTGCG
CAATCTCGCGCTCGCGGCGCAGTCCCGTTCCGACACCACGACCATCTCTTCCAATGCCATCAAATCGATC
AAGTCGCTGATCGCCGGCATTGACAAGATGCTGACGACACAGGTCAACGAAATCCTGCACGCGCCGGAAG
TGCGTGAGATGGAAGGCACATGGCGAGGGCTGTGGTATCTCGTCAACAACACCGAGACGGATCAGAAGCT
GAAGATCCGGGTGATGAACATCTCCAAAGAGCAGCTGGCCGATACGCTTGAAGACTATGAAGGTCAGATG
TGGGACCAGAGCCCGATCTTCAAGAAAGTCTACACAGACGAGTATTCGATGCTTGGCGGCGAACCAATCG
GCTGCGTGATCGGCGCCTACGAGTTCTCCAATCACCCACGTGACGTCGGCCTGCTGCGCAACATCTCCGG
CATCTGCGCTTCCGCGCATACGCCGTTTATCGCGGCCGCTTCGCCGCGCCTATTTCGCATGGACAGCTGG
CAGGAACTGCCGAACCCGCAAGACCTGCAGCAGATCGTCTCCAACCCCGCCTATGCCTCGTGGCAGTCGT
TGCGCGAGAGTGAGGACGCTCGCTACATCGGCCTGACCATGCCCCGCGTCCTGGCGCGGCTGCCCTACGG
CACCGATACCGTTCCGGTGAAGGGTTTCACCTTCGAGGAAGAGGTGGAGGGCGATCACAACAAATATGTC
TGGATGAACGCCGCCTTCCCGATGGGCGTCAACATCAACCGCAGTCACAAGCTTTTCGGCTGGGGCACGC
AGATCCGCGGCGTCGAGAATGGTGGCACGGTGCTCAACCTGCCGGTGCATAGCTTCCCGACCGATGATGG
CTCGATCGCGATGAAATGTCCCACGGAAGTCGCCATCGACGACCGGCGCGAGGCGGAACTGGCCAAGCTT
GGCTTGATGCCCATCCTGCACCGGAAGAATACCGATCTCGCGGCCTTCATCGGAGCACACTCGCTGCAGG
ACGACGAAACGCGGGCGGGGCGGCTGGTCGACCCCGATGCACAGTCGAACGAGCGGCTGAGCGCCAACCT
GCCCTACCTGTTCCCGGTCTCGCGCTTTGCGCACTACCTCAAGGCGATCGCGCGCGACAAGGTCGGCTCG
TTCAAGGAGCGCGCCGACATGCAGATCTGGTTGACCGAGTGGATCAATCGATACGTGCTGGCCAACCCGG
CCTTTGCCGACGACAAGGCGCGCGCCAAGCGCCCGCTTGCCGCCGCCGAGGTCCAGGTGGACAGCGTGGA
GGGGCGGCCGGGCTATTATAATGCCCGCTTCTATCTGCGCCCGCATTACCAGCTGGAGGGCATCAATGCG
TCGCTCCGACTGGTCTCGGAACTACCGTCCGTTAAGACTTGA