SecReT6
Protein ID: 319778108
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6388
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]335959..336498 [-]
Producttype VI secretion protein, vc_a0107 family
NoteTssB
UniProt IDE8TNT5, E8TNT5
KEGG IDmci:Mesci_6388
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.70E-52, Aligned region: 10..170
Protein Sequence: 179 a.a.     [Download]
>gi|319778108|ref|YP_004134538.1| type VI secretion protein, vc_a0107 family [Mesorhizobium ciceri biovar biserrulae WSM1271]
MPAESKAKVIERNRAPRVQIAYDVETYGSPTTIELPFVMGVMADLAGASQTKEASKSVLDRSFVETDANR
FPKFMEALGPRVKARVKNTLPQAEGQERDEELALDLTFSKMGDFAPDKIAEQVPQLAEILKMRRQLEELL
GFMDGRVDAEKRIAQLLNNEPLLGKIASQALADDDKVGE
 
Nucleotide Sequence: 540 bp     [Download]
>gi|319777789|ref|NC_014918.1|:c336498-335959 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGCCAGCCGAAAGCAAAGCCAAGGTCATCGAACGAAATCGCGCGCCGCGGGTGCAGATCGCCTACGATG
TGGAAACCTACGGCAGCCCGACGACGATCGAACTGCCGTTTGTCATGGGCGTGATGGCCGACCTTGCCGG
TGCTTCGCAAACCAAGGAAGCGTCAAAGTCGGTGCTGGACCGCTCCTTTGTCGAGACCGACGCGAACCGC
TTCCCAAAATTCATGGAGGCGCTCGGCCCCCGCGTCAAAGCGCGGGTGAAGAACACGCTGCCGCAGGCCG
AGGGCCAGGAGCGTGACGAGGAACTGGCGCTCGATCTTACATTTTCCAAGATGGGTGATTTCGCCCCCGA
CAAGATTGCCGAGCAAGTTCCGCAACTGGCCGAGATCCTCAAGATGCGTCGACAACTCGAGGAATTGCTC
GGCTTCATGGATGGCCGTGTCGATGCTGAAAAGCGCATCGCGCAGCTTCTGAACAACGAACCGCTTCTTG
GCAAGATTGCCAGCCAGGCGCTGGCCGACGACGACAAGGTTGGGGAATGA