SecReT6
Protein ID: 319778109
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6389
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]336505..337677 [-]
Producttype VI secretion-associated protein, impa family
NoteTssA
UniProt IDE8TNT6, E8TNT6
KEGG IDmci:Mesci_6389
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.60E-19, Aligned region: 57..115
Protein Sequence: 390 a.a.     [Download]
>gi|319778109|ref|YP_004134539.1| type VI secretion-associated protein, impa family [Mesorhizobium ciceri biovar biserrulae WSM1271]
MIDLALWLSSLDGENPSGEDLRNDPAFHELERLTEAQLKVVHDGNNKAGSQSTIPVDWPAVLAKAEELRA
HGRDLRLLVIVTRALANEDGLAGLAQGLTLIAQTFDQHWDTMHPAMRPNASPRDAALRRINALIDLQNGQ
DGLLANLRQMTFFAPRAIGPVQGKDLEKGALDDRVMLQEAASGLNAAEKAQLVSAHGQLLNRVRAACAAQ
IDQANAEMVQLIADARATITALDALETALNARLEGSGTPVPDLKRFLQRLLTTLERNSAAGAVTNGAATQ
AVPTELATPARNGHGADAMASMASYADSSTGLPDRISSRDDVVKCLDLVVAFYDRTEPSSPIPHLARRVR
RMVHMDFVELMEDLAPSGLKEFRLLAGVPDAKKTAQKDER
 
Nucleotide Sequence: 1173 bp     [Download]
>gi|319777789|ref|NC_014918.1|:c337677-336505 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
GTGATTGATCTCGCACTCTGGCTTTCTTCGCTAGACGGTGAGAATCCGTCCGGGGAAGATTTGCGCAACG
ACCCGGCTTTCCATGAGTTGGAGCGCCTGACCGAAGCCCAACTCAAGGTCGTCCACGACGGCAACAATAA
GGCCGGCTCGCAAAGCACGATTCCAGTCGACTGGCCCGCTGTGCTCGCAAAGGCGGAGGAATTGCGCGCG
CATGGCAGGGACTTGCGCCTGCTTGTCATCGTCACGCGCGCGCTGGCCAATGAAGACGGGCTGGCCGGAT
TGGCGCAAGGTCTGACGCTGATCGCGCAGACCTTCGATCAGCATTGGGACACCATGCATCCGGCTATGCG
GCCCAACGCTTCGCCGCGCGATGCCGCCTTGCGCCGTATCAACGCGCTGATCGACCTGCAGAATGGTCAG
GACGGGTTGTTGGCGAATCTGCGGCAAATGACGTTCTTCGCGCCGCGCGCAATCGGCCCGGTTCAGGGCA
AGGACCTGGAGAAGGGTGCGCTCGACGATCGCGTCATGCTCCAGGAAGCCGCCTCGGGGCTGAATGCGGC
GGAAAAAGCGCAGCTGGTCAGTGCGCACGGACAACTCTTGAATCGGGTGCGTGCCGCATGTGCGGCACAG
ATCGATCAGGCCAATGCGGAGATGGTCCAGCTCATCGCCGACGCCCGGGCGACGATCACGGCACTGGATG
CGCTCGAGACTGCGCTCAACGCTCGTCTCGAGGGCAGCGGCACTCCCGTTCCGGACTTAAAACGGTTCCT
GCAGCGTTTGCTGACGACACTTGAACGGAATTCAGCGGCCGGCGCGGTGACGAATGGCGCAGCCACGCAG
GCGGTGCCGACGGAACTGGCAACGCCTGCTCGAAACGGTCATGGAGCCGATGCTATGGCAAGTATGGCAA
GCTATGCGGACTCGAGCACGGGACTCCCCGACCGGATCTCCTCGCGCGACGACGTGGTGAAATGCCTCGA
CCTGGTCGTCGCCTTCTATGACCGTACCGAACCGTCGAGCCCAATTCCGCACCTGGCTCGGCGGGTCCGT
CGGATGGTGCACATGGATTTCGTTGAACTGATGGAAGATCTCGCCCCTTCGGGGCTGAAGGAGTTCAGGC
TGCTGGCCGGCGTTCCCGATGCCAAGAAGACGGCTCAGAAGGATGAAAGGTAA